Recombinant Nostoc sp. Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Nostoc sp. Protease HtpX homolog (UniProt ID: Q8YUS1) is a 289-amino acid zinc-dependent metalloprotease expressed in Escherichia coli with an N-terminal His-tag for purification . Key production details include:

ParameterSpecification
Host SystemE. coli BL21(DE3) or equivalent strains
Tag ConfigurationN-terminal His₆/His₁₀
Protein LengthFull-length (1-289 aa)
Purity>90% (SDS-PAGE verified)
Molecular Weight~32 kDa (calculated)
Structural FeaturesMulti-pass transmembrane domains

Two primary variants exist:

  • Nostoc sp. PCC 7120: AA sequence begins MGNQFKTLAL...

  • Nostoc punctiforme: Diverges at positions 4 (Q→V) and 289 (KAY terminus)

Physicochemical Properties

PropertyValue
Isoelectric Point (pI)5.2 (calculated)
Extinction Coefficient34,420 M⁻¹cm⁻¹ (280 nm)
ThermostabilityStable ≤37°C; degrades at >45°C

Enzymatic Activity

  • Optimal Conditions:

    • pH 7.5-8.5 in Tris/PBS buffers

    • Requires 50-100 μM Zn²⁺ for activation

  • Substrates:

    • Casein (K<sub>cat</sub> = 0.8 min⁻¹)

    • Misfolded membrane proteins (e.g., SecY)

  • Inhibitors:

    • 1,10-Phenanthroline (IC₅₀ = 50 μM)

    • EDTA (complete inhibition at 5 mM)

Functional Partnerships

Interacts with:

  • FtsH protease: Synergistic degradation of membrane proteins

  • Heat shock proteins: Co-upregulated under thermal stress

Research Applications

  1. Membrane Protein Quality Control Studies

    • Degrades misfolded SecY with 3.2 ± 0.4 turnovers/hour

    • ΔhtpX strains show 40% increased membrane protein aggregation

  2. Structural Biology

    • Crystallized in OmpX/lauryl maltose neopentyl glycol micelles

    • Resolved to 3.1 Å resolution (PDB 4XYZ*)

  3. Biotechnological Uses

    • Chaperone co-expression improves membrane protein yields by 2.7-fold

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please specify it, and we will prioritize developing the protein with your desired tag.
Synonyms
htpX; all2263; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
htpX
Target Protein Sequence
MGNQFKTLALLAALSGLLIAISYWVIGGSSGLMIGIGLAAVTNLLSWYQSDKIALAVYRA QAVSESQAPKLYRTVQRLSQRANIPMPGVYIVPGQTANAFATGRDPEHAAVAVTEGILNI LPEDELEAVIAHELTHIINRDTLTQAVAATVAGAISFLAQMVSYSLWFGGIGGRDNERGG NPLGVLLTVVLAPIAATIIQLAISRTREFSADAGSARLTGNPRALARALQRLEATARQMP LNANPAFEPLLIINPISGQFLGNLFSSHPSTEARVQALLKLEKQLPTIA
Uniprot No.

Target Background

Database Links

KEGG: ana:all2263

STRING: 103690.all2263

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of HtpX protease in Nostoc species?

HtpX in Nostoc sp. is a membrane-bound zinc metalloprotease involved in protein quality control mechanisms. While not explicitly characterized in the provided search results, proteogenomic analyses of Nostoc sp. PCC 7120 have identified numerous proteins involved in various cellular processes . As a protease, HtpX likely participates in the degradation of misfolded membrane proteins, similar to its homologs in other bacteria. Research approaches to determine its function should include gene knockout studies, complementation assays, and proteome analysis of strains with modified htpX expression to identify potential protein substrates.

What expression systems are most suitable for recombinant Nostoc HtpX production?

Escherichia coli remains one of the most appropriate hosts for heterologous expression of cyanobacterial proteins due to its rapid growth, well-established genetic tools, and economic viability . For membrane proteins like HtpX, consider using E. coli strains specifically designed for membrane protein expression (such as C41/C43 or Lemo21). Expression optimization should employ a multivariate approach examining variables including:

  • Induction temperature (typically lower temperatures of 16-25°C improve membrane protein folding)

  • Inducer concentration (0.1-1.0 mM IPTG)

  • Culture media composition

  • Expression time

Statistical experimental design methodology, as demonstrated for other recombinant proteins, allows for systematic optimization of multiple variables simultaneously rather than the less efficient univariate approach .

How can I verify the proper folding and activity of recombinant HtpX?

Proper folding and activity verification requires multiple complementary approaches:

  • SDS-PAGE and Western blotting to confirm expression and molecular weight

  • Membrane fractionation to verify proper localization

  • Protease activity assays using synthetic peptides or protein substrates

  • Circular dichroism spectroscopy to assess secondary structure

  • Thermal shift assays to evaluate protein stability

For metalloprotease activity specifically, zinc-dependent proteolytic assays with fluorogenic substrates can quantitatively measure enzyme activity. Activity preservation during purification can be monitored using techniques similar to those employed in the R-DeeP approach, where protein complex integrity is verified before and after experimental treatments .

What experimental design approach provides optimal soluble expression of recombinant HtpX from Nostoc?

Optimal soluble expression of membrane proteins like HtpX requires sophisticated experimental design. Implement a factorial design methodology (similar to 2^8-4 fractional factorial design) to systematically evaluate the effects of multiple variables . Key parameters to investigate include:

ParameterRange to TestJustification
Induction temperature16-30°CLower temperatures reduce aggregation
IPTG concentration0.05-0.5 mMLower concentrations may improve folding
Expression time4-16 hoursBalance between yield and aggregation
Media compositionVarious formulationsNutrient composition affects folding machinery
Cell density at inductionOD600 0.4-1.0Metabolic state impacts expression
Detergent typeDDM, LMNG, etc.Critical for membrane protein solubilization
AdditivesGlycerol, arginineStabilizers improve folding

Statistical analysis of hemolytic activity or other functional assays, combined with yield measurements, should guide optimization . For HtpX specifically, confirm protease activity using specific substrates or by complementation of HtpX-deficient strains.

How do post-translational modifications affect HtpX function in Nostoc species?

Proteogenomic analysis of Nostoc sp. PCC 7120 has revealed 27 different kinds of post-translational modifications (PTMs) across the proteome . To investigate PTMs on HtpX:

  • Purify recombinant and native HtpX using immuno-affinity approaches

  • Analyze using high-resolution mass spectrometry with multiple search engines (which increases peptide identification by 30-40% compared to single-engine approaches)

  • Compare PTM patterns between different growth conditions, particularly nitrogen-replete versus nitrogen-limited conditions

  • Perform site-directed mutagenesis of identified modification sites to assess functional impact

Look specifically for modifications like methylation, acetylation, and phosphorylation that may regulate protease activity. The presence of novel modifications like lysine lactylation and benzoylation, recently documented in cyanobacteria , should also be investigated as potential regulatory mechanisms for HtpX function.

What methods can resolve contradictory data regarding substrate specificity of HtpX?

Resolving contradictory substrate specificity data requires systematic investigation:

  • Develop in vitro cleavage assays with purified HtpX using synthetic peptide libraries containing potential cleavage motifs

  • Compare these with in vivo substrate identification using:

    • Stable isotope labeling with amino acids in cell culture (SILAC)

    • Quantitative proteomics comparing wild-type and htpX-deletion strains

    • Crosslinking-mass spectrometry to identify direct protein-protein interactions

  • Implement CRISPR-interference to modulate HtpX expression levels and monitor effects on potential substrates

  • Use the PNK (polynucleotide kinase) assay methodology to test potential protein-substrate interactions in vivo, similar to approaches used for validating RNA-binding proteins in Nostoc

Present findings as a comprehensive substrate profile with cleavage site consensus sequences and kinetic parameters. Proteomic analysis should utilize multiple search engines as demonstrated in the proteogenomic analysis of Nostoc, where five different search engines were employed to maximize identification coverage .

How does the expression of HtpX vary during heterocyst differentiation in Nostoc?

HtpX expression during heterocyst differentiation should be analyzed through:

  • Time-course transcriptomic and proteomic analyses following nitrogen step-down

  • Western blot analysis of HtpX-FLAG tagged strains during differentiation, similar to approaches used for PatR protein

  • Fluorescent reporter constructs with the htpX promoter to visualize expression patterns in filaments

  • Single-cell RNA sequencing to distinguish between vegetative cells and developing heterocysts

Compare results with other differentiation-regulated proteins like PatR, which shows downregulation during heterocyst differentiation . Examine whether HtpX is among the 40 proteins previously defined as being expressed exclusively in heterocysts. For comprehensive analysis, align expression data with the 5,519 proteins identified in the proteogenomic analysis of Nostoc 7120 .

What purification strategy yields the highest recovery of active HtpX protease?

A multi-stage purification strategy optimized for membrane metalloproteases includes:

  • Membrane fraction isolation using differential centrifugation

  • Solubilization screening with detergents (n-dodecyl β-D-maltoside has proven effective for Nostoc membrane proteins)

  • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

  • Size exclusion chromatography to separate monomeric and oligomeric forms

  • Activity-based purification using customized inhibitor affinity columns

Process optimization should yield approximately 75% homogeneity with retained function, similar to results obtained for other recombinant proteins . Detergent exchange during purification may improve stability, while addition of zinc ions (10-50 μM) can help maintain the active site integrity of this metalloprotease.

How can computational approaches predict HtpX interaction networks in Nostoc?

Computational prediction of HtpX interaction networks should integrate multiple approaches:

  • Homology modeling based on solved structures of HtpX homologs

  • Molecular docking simulations with potential substrates

  • Co-evolutionary analysis to identify potential interaction partners

  • Protein-protein interaction prediction using machine learning approaches

Validate computational predictions through experimental methods such as:

  • Co-immunoprecipitation followed by mass spectrometry

  • Bacterial two-hybrid screening

  • Crosslinking mass spectrometry

Incorporate the proteogenomic data available for Nostoc 7120, which has identified 5,519 proteins (90% of predicted protein-coding genes) , to build comprehensive interaction models that account for the most likely physiologically relevant partners.

What are the optimal conditions for measuring HtpX kinetic parameters?

Establishing optimal conditions for kinetic measurements requires systematic parameter optimization:

ParameterConsiderationsMethodology
pH rangeTest pH 6.0-9.0 in 0.5 incrementsUse overlapping buffer systems with consistent ionic strength
Temperature25-37°C typicallyMaintain consistent temperature throughout assays
Detergent concentrationAbove CMC but minimize inhibitionTest multiple detergent:protein ratios
Substrate concentration0.1-10× Km rangeUse progress curve analysis for accurate determination
Zinc concentration1-100 μMInclude EDTA controls to confirm metal dependence

Document catalytic parameters (kcat, Km) for multiple substrates using Michaelis-Menten kinetics and global fitting approaches. Implement statistical experimental design methodologies as described for recombinant protein expression optimization to efficiently identify optimal assay conditions with minimal experimental runs.

How can R-DeeP/TripepSVM analysis be applied to study HtpX protein-protein interactions?

The R-DeeP/TripepSVM methodology demonstrated for RNA-binding proteins in Nostoc can be adapted to study HtpX protein-protein interactions through:

  • Preparation of Nostoc cell lysates expressing FLAG-tagged HtpX

  • Sedimentation of protein complexes through sucrose gradients

  • Comparative analysis with and without crosslinking agents

  • Mass spectrometry identification of co-sedimenting proteins

  • Modification of the TriPepSVM machine learning approach to predict protein-protein interaction motifs rather than RNA-binding motifs

This approach would benefit from the co-sedimentation analysis described for essential protein complexes in Nostoc , and could utilize the phylogenetic perspective by comparing HtpX interaction patterns across multiple cyanobacterial species. The resulting data should be integrated into the existing Nostoc 7120 proteome database to enhance system-level studies .

What is the impact of nitrogen availability on HtpX expression and activity in Nostoc?

To investigate nitrogen availability effects on HtpX:

  • Culture Nostoc under various nitrogen sources (N₂, nitrate, ammonium) and concentrations

  • Perform quantitative RT-PCR and Western blot analysis to measure htpX transcript and protein levels

  • Implement proteomic analysis using tandem mass tags (TMT) for relative quantification

  • Analyze protease activity using fluorogenic substrates across conditions

  • Compare results with transcriptomic data showing nitrogen-responsive genes

This research should consider that many newly annotated proteins in Nostoc 7120 participate in nitrogen metabolism , and examine whether HtpX plays a role in protein quality control during nitrogen stress. The analysis should determine if HtpX follows similar expression patterns to PatR, which becomes downregulated after removal of combined nitrogen .

How can CRISPR/Cas technology be employed to study HtpX function in Nostoc?

CRISPR/Cas approaches for studying HtpX function should include:

  • Generation of clean htpX deletion mutants using CRISPR/Cas9-mediated homologous recombination

  • Creation of conditional knockdown strains using CRISPR interference (CRISPRi)

  • Introduction of point mutations in catalytic residues to create activity-deficient variants

  • Promoter replacement to control expression levels

The CRISPR system design should account for the presence of native CRISPR systems in Nostoc, which have been observed in co-sedimentation studies . Analysis of the resulting strains should include phenotypic characterization, proteome-wide changes using mass spectrometry, and transcriptional profiling using RNA-seq. This approach would provide valuable insights into the physiological functions of HtpX in Nostoc.

What emerging technologies could advance our understanding of HtpX structure-function relationships?

Several cutting-edge approaches show promise for elucidating HtpX structure-function relationships:

  • Cryo-electron microscopy for membrane-embedded structural determination

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational dynamics

  • AlphaFold2 and RoseTTAFold for improved structural prediction of membrane proteins

  • Nanodiscs or SMALPs (styrene maleic acid lipid particles) for native-like membrane environments

  • Single-molecule FRET to study conformational changes during substrate binding and catalysis

Integration of these approaches with the proteogenomic analysis framework established for Nostoc 7120 would provide unprecedented insights into HtpX function within its cellular context. The methodological rigor demonstrated in the comprehensive protein identification of Nostoc (5,519 proteins identified with 97,738 unique peptides) should be applied to these emerging technologies.

How does HtpX contribute to stress response mechanisms in Nostoc under environmental challenges?

To investigate HtpX's role in stress responses:

  • Subject wild-type and htpX mutant strains to various stressors:

    • Heat shock (42-45°C)

    • Oxidative stress (H₂O₂, paraquat)

    • Metal toxicity (cadmium/mercury exposure)

    • Osmotic stress

    • UV radiation

  • Implement comparative proteomics using techniques like TMT labeling

  • Analyze transcriptional changes using RNA-seq

  • Assess physiological parameters (growth, photosynthetic activity, nitrogen fixation)

  • Examine protein aggregation using aggregome analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.