Recombinant Nostoc sp. Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; alr3340; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
crcB
Target Protein Sequence
MGFGFKILVEQSIQLLTVAPRLVPEVLQQPTIRHPIAVSLGAIAGALSRYYLSLWFAQRF GITFPYGTLFINITGCLAMGFFYALALERLSLISPEIRLLVAVGFLGAYTTFSTYALDTF TLLGDRNLLAAGFYWAGSSILGVISIQIGIILGRLCQ
Uniprot No.

Target Background

Function
Essential for reducing intracellular fluoride concentration and its associated toxicity.
Database Links

KEGG: ana:alr3340

STRING: 103690.alr3340

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of crcB in Nostoc sp. PCC 7120?

The crcB gene in Nostoc sp. PCC 7120 exists in a genomic context that may involve multiple regulatory elements. Similar to other Nostoc genes, it may be regulated by nitrogen-responsive transcription factors like NtcA or stress-responsive elements like LexA, as observed with the recF, recO and recR genes which are regulated by both factors along with heptamer repeats . The genomic neighborhood analysis would be essential to identify potential co-regulated genes and regulatory elements that might influence crcB expression.

What expression systems are recommended for producing recombinant Nostoc sp. CrcB protein?

For recombinant expression of Nostoc sp. CrcB, E. coli expression systems that have been successful with other Nostoc proteins should be considered. Based on methods used for expression of other cyanobacterial proteins, pET vector systems with E. coli BL21(DE3) or its derivatives could be employed. For complementation studies, plasmids with constitutive or inducible promoters (such as the trc promoter system used for all1871 complementation) could be constructed . When expressing membrane proteins like CrcB, strains specifically designed for membrane protein expression, such as C43(DE3), are often advantageous.

How can researchers verify the correct expression of recombinant Nostoc CrcB?

Verification of correct expression requires multiple approaches:

  • Western blotting using antibodies generated against the purified recombinant protein

  • Mass spectrometry analysis of the purified protein

  • Functional complementation assays in appropriate mutants

  • Translational fusions with reporter proteins like GFP, similar to the all1871-gfpmut2 fusion approach described for Nostoc

A comparative approach to expression verification is essential, particularly when dealing with potentially difficult-to-express membrane proteins.

What purification strategies are recommended for Nostoc sp. CrcB protein?

The purification of membrane proteins like CrcB requires specialized approaches:

Purification StageRecommended MethodConsiderations
Cell LysisFrench press/sonicationBuffer with protease inhibitors
Membrane IsolationUltracentrifugation100,000 × g, 1-2 hours
SolubilizationDetergent screeningTest DDM, LMNG, and digitonin
PurificationIMAC followed by SECMaintain detergent above CMC
Quality ControlSDS-PAGE, Western blotVerify oligomeric state

Purification conditions should be optimized to maintain protein stability and function, considering that membrane proteins often require specific detergent environments.

How can researchers determine if recombinant Nostoc CrcB retains its native function?

Functional characterization of recombinant CrcB could employ complementation approaches similar to those used for RecO and RecR proteins from Nostoc, which were shown to complement the corresponding mutations in E. coli . Specific functional assays would include:

  • Fluoride sensitivity assays comparing wild-type and ΔcrcB strains complemented with the recombinant gene

  • Direct measurement of fluoride transport using reconstituted proteoliposomes

  • Binding assays with fluoride ions using isothermal titration calorimetry

  • Structural integrity assessment through circular dichroism

What is known about the structure-function relationship of CrcB proteins in cyanobacteria?

While specific structural information for Nostoc CrcB is limited, insights can be drawn from phylogenetic analysis of related proteins. Similar to the approaches used for RecF/O/R proteins, comparative sequence analysis can reveal conserved domains and critical residues . The structure-function relationship can be further explored through:

  • Homology modeling based on available crystal structures

  • Site-directed mutagenesis of predicted key residues

  • Evolutionary analysis to identify conserved motifs

  • Cross-species functional complementation studies

How is crcB expression regulated in response to environmental conditions in Nostoc sp.?

Based on regulatory patterns observed in other Nostoc genes, crcB expression might be regulated at multiple levels. For example, the nitrogen stress-repressed sRNA NsrR1 regulates expression of all1871 in Nostoc , suggesting potential involvement of sRNAs in crcB regulation. Additionally, transcription factors like NtcA might regulate crcB expression under different nitrogen conditions . Methodological approaches to study this regulation include:

  • qRT-PCR analysis of crcB expression under various environmental conditions

  • Reporter gene assays using the crcB promoter region

  • Identification of potential sRNA interactions through computational prediction and experimental validation

  • Analysis of crcB expression in regulatory mutants (e.g., ΔntcA, ΔlexA)

Does crcB expression vary across different cell types in Nostoc filaments?

Nostoc sp. PCC 7120 is a filamentous cyanobacterium that differentiates specialized cells (heterocysts) for nitrogen fixation. Differential gene expression between cell types has been observed for proteins like All1871 . To investigate whether crcB shows cell type-specific expression patterns, researchers could:

  • Create translational fusions of crcB with fluorescent reporter genes like gfpmut2, as done for all1871

  • Analyze expression using confocal microscopy in filaments growing under different nitrogen conditions

  • Perform cell type-specific transcriptomic or proteomic analysis

  • Use Alcian blue staining in combination with fluorescence microscopy to distinguish heterocysts

How do post-transcriptional mechanisms regulate crcB expression in Nostoc?

Post-transcriptional regulation could play a significant role in crcB expression. In Nostoc, the sRNA NsrR1 directly interacts with the 5'-UTR of all1871 mRNA to affect translation . Similar mechanisms might regulate crcB. Methodological approaches include:

  • Heterologous reporter assays in E. coli using the 5'-UTR of crcB fused to a reporter gene

  • In vitro footprinting experiments to identify potential sRNA interaction sites

  • Mutational analysis of the 5'-UTR to identify regulatory elements

  • Northern blot analysis to assess mRNA stability under different conditions

What genetic manipulation strategies are effective for studying crcB function in Nostoc sp.?

Based on approaches used for other genes in Nostoc, several genetic manipulation strategies could be employed:

StrategyMethodApplication
Gene KnockoutDouble crossover with antibiotic resistance markerGeneration of crcB null mutant
ComplementationTransfer of plasmids like pIAE65 with trc promoterFunctional restoration in mutants
Reporter FusionTranslational fusion with gfpmut2Expression pattern analysis
Controlled ExpressionInducible promoter systemsDose-dependent studies

The generation of a crcB mutant could follow the approach used for the all1871 mutant, involving overlapping PCR fragments and selection with antibiotic resistance markers .

What are the key considerations for interpreting results from fluoride transport assays with recombinant CrcB?

When conducting fluoride transport assays, researchers should consider:

  • Control experiments with non-functional CrcB mutants

  • Verification of protein orientation in reconstituted systems

  • Assessment of background fluoride permeability

  • Evaluation of potential detergent effects on transport activity

  • Standardization of assay conditions (pH, temperature, ion concentrations)

How can researchers address stability issues with recombinant Nostoc CrcB protein?

Stability challenges are common with membrane proteins. Approaches to improve stability include:

  • Screening different detergents and lipid environments

  • Engineering thermostabilizing mutations based on homology modeling

  • Using nanodiscs or amphipols for a more native-like environment

  • Optimizing buffer conditions (pH, salt concentration, additives)

  • Employing fusion partners that enhance stability

How does the interactome of CrcB in Nostoc compare to other bacterial systems?

The interactome of Nostoc proteins can differ significantly from other bacteria. For instance, RecF, RecO, and RecR proteins in Nostoc have a smaller predicted interactome compared to other bacteria, with RecO predicted to interact with both RecF and RecR . For CrcB, potential interaction partners could be identified through:

  • Pull-down assays coupled with mass spectrometry

  • Bacterial two-hybrid screenings

  • In silico prediction based on genomic context

  • Co-purification experiments to identify stable complexes

  • Cross-linking mass spectrometry to capture transient interactions

How can structural information about Nostoc CrcB inform protein engineering applications?

Structural understanding of CrcB can facilitate protein engineering for various applications:

  • Enhancement of fluoride transport efficiency through targeted mutations

  • Development of biosensors by introducing reporter elements at conformationally sensitive sites

  • Engineering altered ion selectivity through modification of the selectivity filter

  • Creation of chimeric proteins with novel functions

  • Designing inhibitors or modulators of fluoride transport

What is the evolutionary significance of CrcB in cyanobacteria compared to other prokaryotes?

Evolutionary analysis of CrcB could provide insights into adaptation mechanisms. Similar to the phylogenetic analysis performed for RecF, RecO, and RecR proteins , a comparative approach could reveal:

  • Conservation patterns across cyanobacterial lineages

  • Adaptation signatures related to specific environmental niches

  • Co-evolution with other fluoride resistance mechanisms

  • Horizontal gene transfer events

  • Structural adaptations unique to cyanobacteria

Table 1: Predicted Properties of Recombinant Nostoc sp. CrcB homolog

PropertyPredicted ValueMethod of Determination
Molecular Weight~12-15 kDaSequence analysis
Transmembrane Domains3-4 per monomerHydropathy analysis
Isoelectric Point~9.2Computed from amino acid sequence
Oligomeric StateHomodimerBased on homology
Expression Level in NostocModerate, condition-dependentPredicted from similar membrane proteins
Subcellular LocalizationPlasma membranePredicted from function and homology

Table 2: Recommended Expression and Purification Conditions

ParameterRecommended ConditionsRationale
Expression HostE. coli C43(DE3)Engineered for membrane protein expression
Expression Temperature18°CLower temperature favors proper folding
Induction0.2 mM IPTG, 16-18 hoursGentle induction prevents inclusion bodies
Solubilization DetergentDDM (1%) or LMNG (0.1%)Mild detergents preserve function
Purification DetergentDDM (0.03%) or LMNG (0.005%)Above critical micelle concentration
Buffer Composition50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerolStabilizing conditions for membrane proteins
Storage-80°C in buffer with 10-20% glycerolPrevents freeze-thaw damage

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.