Recombinant Nostoc sp. Proton extrusion protein PcxA (pcxA)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant PcxA is produced in E. coli expression systems and purified for research use . Key structural and production details include:

Biochemical Functions

PcxA exhibits multifunctional roles in cellular metabolism, as evidenced by proteomic and biochemical studies:

Table 2: Key Biochemical Functions of PcxA

FunctionAssociated Pathways/Proteins
Proton ExtrusionLinked to pH regulation and ion homeostasis
ATP BindingEnergy-dependent transport processes
Metal Ion BindingInteraction with Zn²⁺, Fe³⁺, and Mg²⁺
Ligase ActivityCooperation with PCXB, ITCH, and WWP2 in metabolic pathways

PcxA’s involvement in nitrogen and carbon metabolism is underscored by its interaction with regulatory proteins like PII (GlnB) and glutamyl-tRNA synthetase (gltX) under nitrogen starvation .

Role in Nitrogen Metabolism

Under nitrogen-deprived conditions, PcxA is implicated in heterocyst differentiation, a process essential for nitrogen fixation in cyanobacteria. Exogenous stressors like β-N-methylamino-L-alanine (BMAA) disrupt this process by downregulating nitrogenase (nifH) and heterocyst-specific genes (hetR, hepA) .

Stress Response

Proteomic studies reveal that PcxA-associated pathways are upregulated during oxidative stress, with increased expression of DNA repair enzymes (e.g., RecF, RecO, RecR) and heat shock proteins .

Table 3: Stress-Related Proteins Co-Expressed with PcxA

ProteinFunctionRegulatory Element
RecF/RecODNA repairLexA, heptamer repeats
PII (GlnB)Nitrogen regulationNtcA

Applications in Biotechnology

Recombinant PcxA is widely utilized in:

  • Metabolic Engineering: Studying carbon fixation and nitrogen assimilation in cyanobacteria .

  • Stress Response Studies: Analyzing oxidative stress tolerance in extremophiles .

  • Structural Biology: Resolving ion transport mechanisms via crystallography .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
pcxA; all1673; Proton extrusion protein PcxA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-467
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
pcxA
Target Protein Sequence
MPTMRNSIFSEKIYPILLSAYRWYLRTPERSLEEAYKAALNIKAIEDEHFNGNKIDFNSA IYSNSVMDYFESDLAQELKTARMRLTEFRFSRWFSNESHQKAARKAGIEYPSSNVTLEKL KFIDEVISKYIITDYEIVAPSGVSESQVRTTSSQPPENPSLTDALRTNDINKNNLVERIY TPTSPPQLIKQRTEQSKKSRGKADTTGILPRSILSTIGRLQIELDPNAEQDVINNFRQAQ KRSIISIRFILLIIIVPLLTHQLSKALIVSPIFNHFKNDHTEQIFLNSEMEEEALSTLHR FEERIKFENLISNAPPLSAEAIETQIKEKAEELAAEFRGESSNAIKNVFADIFSVGAFIW LLLVSKPSIMVLKEFFDNVVYGLSDSAKAFIIILFTDVFVGFHSPHGWEVILEGLSRHWG LPANRDFIFLFIATFPVILDTIFKYWIFRYLNRISPSAVATYRNMNE
Uniprot No.

Target Background

Function
Recombinant Nostoc sp. Proton extrusion protein PcxA (pcxA) is involved in light-induced Na(+)-dependent proton extrusion. It is also believed to participate in CO(2) transport.
Database Links

KEGG: ana:all1673

STRING: 103690.all1673

Protein Families
Cema family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is PcxA protein and what is its documented cellular function in Nostoc sp.?

PcxA (Proton extrusion protein A) is a membrane protein encoded by the pcxA gene (locus name all1673) in Nostoc sp. (strain PCC 7120 / UTEX 2576) . The protein consists of 467 amino acids and functions primarily in proton transport across cellular membranes, which is essential for maintaining pH homeostasis and establishing electrochemical gradients in cyanobacteria. Experimental approaches to study PcxA function typically involve membrane isolation techniques, followed by reconstitution of the protein into liposomes to measure proton transport activity. Researchers often employ pH-sensitive fluorescent dyes such as BCECF or pyranine to visualize and quantify proton movement in real-time experiments. Genetic knockout studies of pcxA in Nostoc sp. PCC 7120 can help determine the physiological significance of this protein by assessing changes in growth, photosynthetic efficiency, and adaptation to varying pH conditions. The protein's highly conserved domains suggest evolutionary importance in cyanobacterial physiology and potential interactions with other membrane transport systems.

How can researchers effectively study PcxA involvement in proton extrusion mechanisms?

Researchers investigating PcxA's role in proton extrusion mechanisms should employ multiple complementary approaches to obtain comprehensive functional data . Patch-clamp electrophysiology represents a powerful technique for directly measuring proton currents through PcxA channels in either native membranes or heterologous expression systems. Measuring intracellular pH changes in response to environmental stimuli using ratiometric fluorescent probes can establish correlations between PcxA activity and cellular pH regulation. Reconstitution of purified recombinant PcxA into proteoliposomes with pH-sensitive fluorophores trapped inside allows for controlled assessment of proton transport kinetics and directionality. Researchers should also implement site-directed mutagenesis targeting conserved regions of PcxA to identify critical residues involved in proton sensing, channel formation, or gating mechanisms. Integration of these methodologies with structural studies using techniques like cryo-electron microscopy can provide insights into the conformational changes associated with proton translocation through PcxA channels.

What experimental techniques are most effective for purifying and characterizing recombinant PcxA?

Successful purification and characterization of recombinant PcxA requires specialized techniques optimized for membrane proteins . Expression systems utilizing E. coli strains specifically designed for membrane protein production (such as C41(DE3) or C43(DE3)) typically yield better results than standard laboratory strains. The recombinant protein should be extracted using mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) that maintain protein structure and function. Purification typically involves immobilized metal affinity chromatography (IMAC) using histidine tags, followed by size exclusion chromatography to achieve high purity. Functional characterization should include proteoliposome-based proton transport assays using pH-sensitive fluorophores and direct binding studies with potential substrates or inhibitors. Circular dichroism spectroscopy provides valuable information about secondary structure integrity and thermal stability of the purified protein. Researchers should store the purified protein in appropriate buffer conditions (typically Tris-based buffer with 50% glycerol) at -20°C for short-term storage or -80°C for extended periods, avoiding repeated freeze-thaw cycles as recommended for this specific protein .

How is PcxA potentially related to nitrogen metabolism in Nostoc sp.?

The relationship between PcxA and nitrogen metabolism in Nostoc sp. represents an important area of investigation, particularly given the significant role of proton gradients in nitrogen fixation processes . Proteomic studies of Nostoc sp. PCC 7120 under nitrogen starvation conditions have revealed complex regulatory networks involving numerous proteins, though direct evidence for PcxA's involvement requires further research. Methodologically, researchers should employ co-expression studies examining pcxA expression patterns alongside key nitrogen metabolism genes such as nifD, glnB, and nrtA under varying nitrogen conditions. Confocal microscopy with fluorescently-tagged PcxA can determine whether the protein localizes near heterocysts, the specialized cells responsible for nitrogen fixation in filamentous cyanobacteria. Measurements of intracellular pH and membrane potential in wild-type versus pcxA knockout strains during nitrogen step-down experiments would elucidate whether PcxA contributes to the bioenergetic requirements of nitrogen assimilation. Chromatin immunoprecipitation (ChIP) assays could identify potential regulatory interactions between nitrogen response regulators and the pcxA promoter region, providing mechanistic insights into how nitrogen availability might influence PcxA expression.

What is the predicted structure of PcxA and how might it relate to its function?

The structure of PcxA can be predicted through computational approaches combined with experimental validation techniques . Homology modeling based on structurally characterized proton transporters suggests PcxA likely contains multiple transmembrane α-helices that form a proton-conducting channel across the membrane. Key structural features predicted in PcxA include a conserved proton-sensing domain and transmembrane regions rich in acidic and basic residues that participate in proton translocation. Methodologically, researchers should employ hydropathy plot analysis to identify transmembrane segments followed by topology prediction algorithms to generate initial structural models. These computational predictions should be validated experimentally using techniques such as cysteine scanning mutagenesis coupled with accessibility measurements or selective proteolysis with mass spectrometry. For higher-resolution structural information, researchers should pursue cryo-electron microscopy or X-ray crystallography, though these approaches require significant optimization for membrane proteins like PcxA. Functional correlations can be established by introducing point mutations at predicted functionally important residues, followed by transport assays to assess how structural alterations affect proton transport capacity.

How does PcxA interact with other proteins in Nostoc sp. metabolism?

Understanding PcxA's protein-protein interaction network is essential for elucidating its broader role in Nostoc sp. cellular physiology . Researchers should employ co-immunoprecipitation (co-IP) coupled with mass spectrometry to identify proteins that physically associate with PcxA under various physiological conditions. Bacterial two-hybrid assays can validate direct protein-protein interactions, while proximity labeling techniques like BioID or APEX2 can identify neighboring proteins in the native membrane environment. Functional interactions can be explored through suppressor screens in pcxA mutant backgrounds to identify genes that can compensate for PcxA deficiency when overexpressed. Blue native polyacrylamide gel electrophoresis (BN-PAGE) can determine whether PcxA forms part of larger protein complexes in the membrane. Comparative proteomic analysis between wild-type and pcxA knockout strains, similar to the approach used in studies of BMAA effects on Nostoc sp. PCC 7120, can reveal downstream proteomic changes resulting from PcxA deficiency . The table below summarizes potential protein interaction candidates based on functional relatedness to proton transport and membrane processes:

Protein CategoryExample ProteinsInteraction Detection MethodFunctional Significance
Photosystem ProteinsPsaA, PetCCo-IP, BN-PAGEEnergy coupling to proton transport
pH HomeostasisCarbonic anhydrases, Na+/H+ antiportersSuppressor screens, FRETpH regulation coordination
Nitrogen MetabolismGlnB, NifDCo-expression analysis, BioIDBioenergetic coupling to N-fixation
Membrane OrganizationLipid biosynthesis enzymesLipidomics in pcxA mutantsMembrane composition effects
Redox HomeostasisThioredoxins, PeroxiredoxinsRedox proteomicsRegulation by redox state

What are the challenges in expressing functional recombinant PcxA and how can they be overcome?

Expressing functional recombinant PcxA presents several technical challenges that require specialized approaches . Membrane proteins like PcxA often cause toxicity in expression hosts due to membrane crowding or disruption of the host's membrane potential. To address this, researchers should use tightly controlled inducible expression systems and lower cultivation temperatures (16-20°C) to slow protein synthesis and improve folding. Codon optimization of the pcxA gene for the expression host can enhance translation efficiency, while fusion tags such as MBP (maltose-binding protein) can improve solubility and folding. For proper membrane insertion, expression vectors that target the protein to the bacterial membrane via signal sequences like pelB may improve yields of correctly folded protein. Post-extraction stabilization requires screening multiple detergents (beyond the standard DDM) at various concentrations to identify optimal solubilization conditions that preserve function. Functional validation is essential, as high protein yields do not guarantee biological activity; therefore, researchers should develop robust activity assays to confirm that the recombinant protein retains proton transport capabilities. Cell-free expression systems represent an alternative approach that can circumvent toxicity issues by expressing PcxA directly into artificial membrane environments.

How does PcxA activity potentially change under different environmental conditions?

PcxA activity likely responds to various environmental factors that affect cellular proton homeostasis requirements . To investigate these responses methodologically, researchers should implement controlled environmental chamber experiments with Nostoc cultures under varying conditions while monitoring pcxA expression and protein activity. Light intensity modulation experiments can determine whether PcxA activity correlates with photosynthetic proton generation, using PAM fluorometry to simultaneously measure photosynthetic parameters. pH shift assays measuring recovery kinetics in wild-type versus pcxA knockout strains can quantify the contribution of PcxA to acid/base stress responses. Temperature-dependent activity assays using reconstituted PcxA in proteoliposomes can establish the thermal profile of PcxA function, which is particularly relevant for organisms inhabiting variable environments. Researchers should also consider heavy metal exposure experiments, as many proton transporters are regulated by or transport metal ions as secondary substrates. Proteomic profiling under these various conditions, similar to the approach used in the BMAA study of Nostoc sp. PCC 7120, can provide comprehensive insights into how PcxA expression and associated proteins respond to environmental perturbations .

What are the comparative differences in PcxA across different cyanobacterial species?

Comparative analysis of PcxA homologs across cyanobacterial species can provide evolutionary insights and functional information . Researchers should begin with comprehensive phylogenetic analysis using both maximum likelihood and Bayesian approaches to establish evolutionary relationships between PcxA proteins from diverse cyanobacteria. Multiple sequence alignment can identify conserved residues likely essential for function versus variable regions that might confer species-specific adaptations. Expression of PcxA homologs from different species in a common genetic background (e.g., a pcxA knockout of Nostoc sp. PCC 7120) followed by phenotypic analysis can determine functional conservation or specialization. Domain swapping experiments between PcxA variants from different habitats (acidic, alkaline, marine, freshwater) can identify regions responsible for adaptation to specific environmental niches. Structural modeling of PcxA variants can predict species-specific differences in transport kinetics, substrate specificity, or regulatory mechanisms. Conservation analysis should also extend to genomic context, examining whether pcxA is consistently associated with particular gene clusters across species, which might indicate functional relationships or co-regulation patterns.

How can mutational studies of PcxA inform our understanding of proton transport mechanisms?

Systematic mutational analysis of PcxA provides powerful insights into structure-function relationships governing proton transport . Researchers should implement alanine scanning mutagenesis across the entire protein sequence, focusing particularly on charged and polar residues likely involved in proton transfer. Each mutant should undergo comprehensive functional characterization using proteoliposome-based transport assays to measure changes in transport kinetics (Vmax, Km) and directionality. pH-dependent activity profiles of wild-type versus mutant proteins can identify residues involved in pH sensing or regulation. Introduction of cysteine pairs at various positions followed by crosslinking studies can map conformational changes associated with transport cycles. Intragenic suppressor screens, where second-site mutations are selected that restore function to inactive primary mutants, can identify functionally coupled residues within the protein structure. Hydrogen-deuterium exchange mass spectrometry comparing wild-type and mutant proteins can identify regions with altered solvent accessibility or dynamics. Integration of these experimental data with molecular dynamics simulations can generate comprehensive mechanistic models of proton translocation through PcxA.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.