Recombinant Nostoc sp. Putative zinc metalloprotease all3971 (all3971)

What is the basic structure and properties of Nostoc sp. Putative zinc metalloprotease all3971?

Recombinant Nostoc sp. Putative zinc metalloprotease all3971 (all3971) is a full-length protein consisting of 364 amino acid residues derived from the cyanobacterial genus Nostoc sp. (strain PCC 7120 / UTEX 2576) . The protein has a UniProt accession number of Q8YQ64 and is classified as EC 3.4.24.-, indicating its function as a metalloendopeptidase . The complete amino acid sequence begins with MSVLAAIAVLAVLILVHELGHFVAARSQGIHVNRFSLGFGPVLWKYQGAETEYAIRAFPL and continues as documented in the protein database .

Like other zinc metalloproteases, all3971 likely contains characteristic zinc-binding motifs that are essential for its catalytic activity. Based on comparative analysis with similar metalloproteases, it likely possesses a molecular weight of approximately 38,000 Da and would be expected to have an acidic isoelectric point, possibly around 4.4-5.2, though the specific pI for all3971 would need to be experimentally determined .

How should Recombinant Nostoc sp. all3971 be stored to maintain optimal activity?

For optimal storage of Recombinant Nostoc sp. Putative zinc metalloprotease all3971, the protein should be maintained at -20°C in a Tris-based buffer containing 50% glycerol optimized for protein stability . For extended storage periods, conservation at -80°C is recommended to prevent activity loss .

To preserve enzyme activity, it's crucial to avoid repeated freeze-thaw cycles as these can significantly decrease protein stability and function. For ongoing experiments, working aliquots should be prepared and stored at 4°C for up to one week to minimize degradation from repeated freezing and thawing . This protocol follows standard practices for maintaining metalloproteases, which are known to be relatively heat labile based on studies of similar enzymes .

What expression systems are commonly used for producing Recombinant Nostoc sp. all3971?

The predominant expression system used for producing Recombinant Nostoc sp. Putative zinc metalloprotease all3971 is Escherichia coli . This bacterial expression system is favored for its efficiency in producing recombinant proteins, relative simplicity, and cost-effectiveness for research purposes.

When expressed in E. coli, the protein is typically tagged to facilitate purification, with His-tagging being a common approach . The specific tag used may vary depending on the purification strategy and experimental requirements of individual research groups . The expression region generally encompasses the full-length protein (amino acids 1-364) , though some researchers may opt for expressing specific domains for specialized structural or functional studies.

What are the optimal conditions for measuring enzymatic activity of all3971, and how does it compare to other zinc metalloproteases?

The optimal conditions for measuring enzymatic activity of all3971 should be established through systematic evaluation of temperature, pH, and buffer composition. Based on studies of similar zinc metalloproteases, the enzyme would likely exhibit maximal activity at moderate temperatures (approximately 37°C) and within a pH range of 5-7 .

For activity assays, researchers should consider:

• Substrate selection: Based on analogous zinc metalloproteases, all3971 would likely show activity against azocasein, azocoll, and potentially insoluble casein, but may not have activity against elastin .

• Assay methodology: A standard approach involves incubating the enzyme with azocasein at 37°C for 30 minutes, with one protease unit defined as the amount resulting in an absorbance of 1 at 440nm .

• Validation controls: Include appropriate positive controls (known metalloproteases) and negative controls (heat-inactivated enzymes).

Compared to other zinc metalloproteases, all3971 likely shares the characteristic inhibition by metalloprotease inhibitors such as ortho-phenanthroline and Zincov, while remaining unaffected by serine protease inhibitors like phenylmethylsulfonyl fluoride and N-ethylmaleimide .

What strategies can be employed for purification of Recombinant Nostoc sp. all3971 to achieve high purity for structural studies?

For high-purity preparation of Recombinant Nostoc sp. all3971 suitable for structural studies, a multi-step purification strategy is recommended:

• Initial capture: For His-tagged recombinant all3971, immobilized metal affinity chromatography (IMAC) provides an effective first purification step with high selectivity for the target protein.

• Intermediate purification: Following the initial capture, sequential chromatography steps similar to those used for related metalloproteases should be employed:

  • Ammonium sulfate precipitation to remove major contaminants

  • Gel filtration chromatography using Sephadex G-100 to separate based on molecular size

  • Hydrophobic interaction chromatography with phenyl-Sepharose CL-4B for separating proteins based on surface hydrophobicity

  • A second gel filtration step with Sephadex G-100 for final polishing

• Quality assessment: Purity should be verified by SDS-PAGE (aiming for >85% purity), and activity should be confirmed using standard protease assays .

• Storage considerations: For structural studies, the purified protein should be maintained in a buffer that minimizes aggregation while maintaining native conformation, typically with glycerol as a stabilizing agent .

This purification approach has been demonstrated to yield homogeneous preparations of zinc metalloproteases suitable for detailed structural and functional characterization .

How can researchers distinguish between the activity of all3971 and other metalloproteases in complex biological samples?

Distinguishing the specific activity of all3971 from other metalloproteases in complex biological samples requires a multi-faceted approach:

• Inhibitor profiling: Utilize a panel of protease inhibitors to create an inhibition fingerprint. While all3971 would likely be inhibited by metalloprotease-specific inhibitors like ortho-phenanthroline and Zincov, it should remain unaffected by inhibitors targeting other protease classes such as phenylmethylsulfonyl fluoride (serine proteases) and N-ethylmaleimide (cysteine proteases) .

• Substrate specificity analysis: Compare hydrolysis rates across multiple substrates (azocasein, azocoll, insoluble casein, elastin) to establish a substrate preference pattern that can differentiate all3971 from other proteases .

• pH and temperature optima: Characterize the activity profile across pH ranges (4-10) and temperatures (25-65°C) to identify distinctive operational parameters for all3971 .

• Immunological methods: Develop specific antibodies against all3971 for immunoprecipitation, activity depletion studies, or Western blotting to specifically identify and quantify the enzyme in complex mixtures.

• Mass spectrometry: For definitive identification, utilize liquid chromatography-tandem mass spectrometry (LC-MS/MS) to identify peptide fragments specific to all3971 after enzymatic digestion.

By combining these approaches, researchers can create a discriminative profile that distinguishes all3971 activity from that of other metalloproteases in biological samples.

What experimental protocols are recommended for characterizing the zinc-binding properties of all3971?

To comprehensively characterize the zinc-binding properties of Recombinant Nostoc sp. Putative zinc metalloprotease all3971, researchers should implement the following experimental protocols:

• Metal content analysis: Inductively coupled plasma mass spectrometry (ICP-MS) should be used to quantitatively determine the zinc content per protein molecule. This establishes the stoichiometry of zinc binding.

• Zinc-binding motif identification: Sequence analysis should focus on identifying the three well-characterized zinc-binding and active-site motifs typically present in bacterial zinc metalloproteases . These conserved motifs generally include HEXXH (where X is any amino acid) and additional coordinating residues.

• Metal chelation studies: Determine the effect of increasing concentrations of chelating agents (EDTA, EGTA, ortho-phenanthroline) on enzymatic activity. The concentration-dependent inhibition curve provides insights into the affinity of zinc binding .

• Metal reconstitution experiments: After removing zinc with chelators, attempt to restore activity by adding back various metal ions (Zn²⁺, Co²⁺, Mn²⁺, Ni²⁺, Cu²⁺) to determine metal specificity and potential for metal substitution.

• Structural characterization: For advanced studies, X-ray crystallography or NMR spectroscopy can provide detailed information about the coordination geometry of the zinc-binding site and the amino acid residues involved in metal coordination.

These methods collectively provide a comprehensive profile of the zinc-binding characteristics essential for the catalytic function of all3971.

How can researchers design experiments to investigate the substrate specificity of all3971?

To systematically investigate the substrate specificity of all3971, researchers should design a comprehensive experimental approach:

• Synthetic peptide library screening: Utilize a positional scanning synthetic combinatorial library (PS-SCL) containing diverse peptide sequences to identify preferred amino acid residues at positions P4-P4' surrounding the cleavage site.

• Natural substrate screening: Test activity against various protein substrates including:

  • General protease substrates: Azocasein, azocoll, and insoluble casein

  • Extracellular matrix components: Collagen, elastin, fibronectin, and laminin

  • Bioactive peptides: Various hormone precursors and signaling peptides

• Cleavage site mapping: For identified substrates, perform mass spectrometry analysis of digestion products to determine precise cleavage sites, which can be aligned to establish a consensus sequence.

• Kinetic parameter determination: For identified substrates, determine kinetic parameters (Km, kcat, kcat/Km) to quantitatively assess substrate preference.

• Structural modeling: Perform in silico docking studies using the predicted or determined structure of all3971 to analyze substrate binding pocket interactions.

This systematic approach allows for a comprehensive characterization of substrate preferences that may provide insights into the biological function and potential applications of all3971.

What analytical techniques are most effective for studying potential inhibitors of all3971 activity?

For studying potential inhibitors of all3971 activity, several complementary analytical techniques should be employed:

• Enzyme inhibition assays: Standard enzyme inhibition assays using azocasein as substrate should be conducted with various classes of inhibitors. Key compounds to test include:

  • Metalloprotease-specific inhibitors: ortho-phenanthroline, Zincov, EDTA, and 1,10-phenanthroline

  • Broad-spectrum inhibitors: α2-macroglobulin, TIMP (tissue inhibitors of metalloproteases)

  • Class-specific inhibitors: Phenylmethylsulfonyl fluoride (serine proteases), N-ethylmaleimide (cysteine proteases), and various trypsin inhibitors

• Inhibition kinetics: For promising inhibitors, determine inhibition constants (Ki) and mechanisms of inhibition (competitive, non-competitive, uncompetitive, or mixed) using Lineweaver-Burk, Dixon, or more modern non-linear regression analyses.

• Thermal stability assays: Differential scanning fluorimetry (DSF) can assess inhibitor binding by measuring shifts in protein melting temperature upon inhibitor binding.

• Structure-activity relationship (SAR) studies: For lead inhibitors, test structural analogues to identify key molecular features required for inhibition.

• Binding affinity measurements: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can provide direct measurements of binding affinity and thermodynamic parameters of inhibitor-enzyme interactions.

These techniques provide comprehensive characterization of inhibitor potency, selectivity, and mechanism, which is crucial for understanding enzyme function and potentially developing specific research tools.

How does all3971 compare structurally and functionally to zinc metalloproteases from other cyanobacterial species?

Structurally and functionally, all3971 from Nostoc sp. shares significant similarities with zinc metalloproteases from other cyanobacterial species, yet retains distinctive features:

• Sequence homology: Based on the available data, all3971 likely shares sequence similarity with zinc metalloproteases from other cyanobacteria, particularly in the conserved zinc-binding motifs and catalytic domains . The N-terminal sequence of all3971 may show 23-27 identical residues out of the first 42 amino acids when compared to proteases from related organisms, as observed in similar metalloproteases .

• Structural comparison:

  • Molecular weight: all3971 has a predicted size of approximately 37-38 kDa, which is consistent with other characterized bacterial zinc metalloproteases

  • Isoelectric point: The predicted pI of 5.23 based on amino acid composition places it in the acidic range similar to other bacterial metalloproteases

  • Domain organization: The protein likely contains an N-terminal signal sequence, a catalytic domain with zinc-binding motifs, and potentially a C-terminal domain involved in substrate recognition

• Functional comparison:

  • Substrate specificity: Like other cyanobacterial metalloproteases, all3971 would be expected to hydrolyze proteinaceous substrates such as azocasein and azocoll

  • Optimal conditions: Most cyanobacterial metalloproteases function optimally at neutral to slightly acidic pH (5-7) and moderate temperatures (30-40°C)

  • Inhibition profile: The enzyme would likely be inhibited by typical metalloprotease inhibitors such as ortho-phenanthroline and Zincov

Understanding these comparative aspects is crucial for positioning all3971 within the broader context of cyanobacterial proteases and for leveraging knowledge from better-characterized enzymes to predict and explain the properties of all3971.

What are the potential roles of all3971 in Nostoc sp. biology and ecological interactions?

The potential biological and ecological roles of all3971 in Nostoc sp. can be inferred from the general functions of metalloproteases in cyanobacteria:

• Protein turnover and homeostasis: As a zinc metalloprotease, all3971 likely participates in the degradation of misfolded or damaged proteins, contributing to cellular protein quality control systems essential for survival under changing environmental conditions.

• Nutrient acquisition: In nutrient-limited environments, extracellular proteases can degrade environmental proteins into peptides and amino acids that can be assimilated by the organism. Given that Nostoc species are common in soil environments , all3971 may contribute to nutrient scavenging.

• Biofilm formation and dispersal: Metalloproteases often play roles in biofilm dynamics by modifying extracellular matrix components. Nostoc species are known to form complex biofilms and microbial mats, suggesting potential involvement of all3971 in these processes.

• Developmental processes: Nostoc species undergo complex developmental cycles including heterocyst formation and hormogonia differentiation. Proteolytic processing by enzymes like all3971 may regulate protein factors involved in these developmental transitions.

• Defense mechanisms: Some bacterial proteases target antimicrobial peptides or proteins produced by competing organisms. all3971 might contribute to Nostoc's competitive fitness in microbial communities.

• Secondary metabolite processing: Nostoc species are prolific producers of bioactive secondary metabolites . all3971 could potentially be involved in the maturation or modification of peptide-based secondary metabolites, contributing to the chemical diversity of compounds produced by Nostoc.

Understanding these potential roles provides context for research into the physiological significance of all3971 and its possible biotechnological applications.

How can structural information about all3971 be used to design specific inhibitors for research applications?

Designing specific inhibitors for all3971 based on structural information involves a systematic structure-based drug design approach:

• Structural determination: The first step is obtaining detailed structural information about all3971 through:

  • X-ray crystallography of the purified protein, ideally in complex with substrate analogs or known inhibitors

  • Homology modeling based on closely related zinc metalloproteases with known structures

  • Molecular dynamics simulations to understand flexibility and accessible conformations of the active site

• Active site mapping: Analyze the active site architecture to identify:

  • The catalytic zinc ion coordination sphere

  • Substrate binding pockets (S1, S2, S3, S1', S2', S3')

  • Key residues involved in substrate recognition and catalysis

  • Unique structural features that differentiate all3971 from other metalloproteases

• Inhibitor design strategies:

  • Zinc-binding groups: Incorporate appropriate zinc-chelating moieties such as hydroxamates, thiols, carboxylates, or phosphinates with optimal geometry for coordination

  • Peptide backbone mimics: Design peptidomimetics that occupy the substrate binding pockets while resisting proteolytic cleavage

  • Non-peptidic scaffolds: Develop small molecule inhibitors that occupy key recognition pockets without peptide character

• Selectivity engineering:

  • Target unique features of all3971 active site that differ from human metalloproteases

  • Incorporate structural elements that interact with non-conserved residues surrounding the active site

  • Optimize inhibitor properties to maximize affinity for all3971 while minimizing interaction with other metalloproteases

• Validation and refinement:

  • Test candidate inhibitors in biochemical assays against all3971 and related metalloproteases

  • Determine co-crystal structures of promising inhibitors bound to all3971

  • Iteratively refine inhibitor structure based on structural and biochemical data

This structure-based approach can yield highly specific research tools that enable selective inhibition of all3971 for investigating its biological functions and potential applications.

What are common challenges in expressing and purifying active all3971, and how can they be addressed?

Researchers working with Recombinant Nostoc sp. Putative zinc metalloprotease all3971 often encounter several challenges during expression and purification. Here are these challenges and recommended solutions:

• Protein solubility issues:

  • Challenge: Metalloproteases often form inclusion bodies when overexpressed in E. coli

  • Solutions:
    a) Lower induction temperature (16-20°C) and IPTG concentration
    b) Use solubility-enhancing fusion tags (SUMO, MBP, or TrxA)
    c) Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)
    d) Consider alternative expression systems (Pichia pastoris, insect cells)

• Proteolytic auto-degradation:

  • Challenge: Active metalloproteases can self-cleave during expression and purification

  • Solutions:
    a) Express as inactive pro-enzyme form when possible
    b) Add metalloprotease inhibitors (EDTA, ortho-phenanthroline) during purification
    c) Maintain strict temperature control (4°C) throughout purification
    d) Minimize purification time with optimized protocols

• Metal ion incorporation:

  • Challenge: Obtaining correctly folded enzyme with properly incorporated zinc

  • Solutions:
    a) Supplement expression media with ZnCl₂ (10-100 μM)
    b) Include zinc in purification buffers (1-10 μM)
    c) Consider metal ion exchange/reconstitution after purification
    d) Verify zinc content by atomic absorption spectroscopy or ICP-MS

• Storage stability:

  • Challenge: Activity loss during storage

  • Solutions:
    a) Store in optimized buffer with 50% glycerol at -20°C or -80°C
    b) Avoid repeated freeze-thaw cycles by preparing single-use aliquots
    c) Add stabilizing agents (glycerol, trehalose, or BSA)
    d) Monitor activity periodically to establish stability profiles

• Recombinant tag interference:

  • Challenge: His-tags or other purification tags affecting enzyme activity

  • Solutions:
    a) Compare activity with and without tag cleavage
    b) Position tags (N- or C-terminal) based on structural information
    c) Use cleavable tags with specific proteases (TEV, PreScission)
    d) Consider tag-free purification methods if necessary

By systematically addressing these challenges, researchers can significantly improve the yield and quality of active recombinant all3971 for subsequent studies.

What are the most sensitive methods for detecting low levels of all3971 activity in complex biological samples?

Detecting low levels of all3971 activity in complex biological samples requires highly sensitive methodologies:

• Fluorogenic substrate assays:

  • Methodology: Utilize custom-designed fluorogenic peptide substrates with quenched fluorophores that emit fluorescence upon cleavage

  • Advantages: Extremely sensitive (picomolar detection limits), real-time monitoring capability, potential for high-throughput screening

  • Implementation: Select peptide sequences based on known or predicted substrate preferences of all3971, with FRET pairs (e.g., EDANS/DABCYL) flanking the cleavage site

• Zymography techniques:

  • Methodology: SDS-PAGE with gelatin, casein, or custom substrate incorporated into the gel matrix

  • Advantages: Permits visualization of proteolytic activity after electrophoretic separation, allowing multiple proteases to be distinguished by molecular weight

  • Enhancement: Include zinc in the renaturation buffer and perform the assay at optimal pH for all3971 activity; use in-gel inhibitor studies with control lanes containing ortho-phenanthroline to confirm metalloprotease identity

• MALDI-TOF mass spectrometry:

  • Methodology: Incubate biological samples with specific peptide substrates and analyze cleavage products by mass spectrometry

  • Advantages: Precise identification of cleavage sites, high specificity, useful for complex samples

  • Implementation: Design substrate peptides with known mass that yield distinctive fragment patterns upon cleavage by all3971

• Activity-based protein profiling (ABPP):

  • Methodology: Utilize activity-based probes that covalently bind to the active site of functional metalloproteases

  • Advantages: Directly labels active enzymes, high sensitivity, compatible with complex samples

  • Implementation: Design zinc-binding hydroxamate probes with biotin or fluorescent tags for detection

• Enzyme-linked immunosorbent assay (ELISA):

  • Methodology: Develop a sandwich ELISA with antibodies specific to all3971

  • Advantages: High specificity and sensitivity, quantitative results, automation potential

  • Enhancement: Combine with activity assays to specifically detect active enzyme rather than total protein

These methods provide complementary approaches for detecting low levels of all3971 activity, with selection depending on the specific research context and available resources.

What are the most promising research directions for understanding the physiological roles of all3971 in Nostoc sp.?

Future research on all3971 should focus on several promising directions to elucidate its physiological roles in Nostoc sp.:

• Gene knockout and phenotypic analysis: Generating all3971 deletion mutants in Nostoc sp. and characterizing their phenotypes under various environmental conditions would provide direct evidence of the protein's physiological functions. Particular attention should be paid to growth rates, biofilm formation, response to stress conditions, and interactions with other organisms.

• Substrate identification in vivo: Employing proteomic approaches such as TAILS (Terminal Amine Isotopic Labeling of Substrates) or PICS (Proteomic Identification of protease Cleavage Sites) to identify natural substrates of all3971 within Nostoc cells or in their extracellular environment would provide crucial insights into its biological roles.

• Transcriptional regulation studies: Analyzing the expression patterns of all3971 under different environmental conditions (nutrient limitation, light regimes, temperature stress) could reveal regulatory mechanisms and suggest functional contexts.

• Protein localization: Determining the subcellular localization of all3971 using fluorescent protein fusions or immunolocalization techniques would provide spatial context for its function and potential interaction partners.

• Ecological studies: Investigating the role of all3971 in Nostoc's interactions with other microorganisms, plants (particularly in symbiotic relationships), or potential predators would illuminate its significance in ecological contexts.

• Comparative analysis: Studying all3971 homologs across different Nostoc strains and other cyanobacterial genera to identify conserved and divergent features that might correlate with specific ecological niches or physiological adaptations.

• Secondary metabolite processing: Given that Nostoc species produce numerous bioactive compounds, including nodularin and pseudospumigins , investigating whether all3971 participates in the processing or maturation of these compounds could reveal connections to secondary metabolism.

These research directions would collectively contribute to a comprehensive understanding of all3971's roles in Nostoc biology and potentially reveal novel functions of zinc metalloproteases in cyanobacteria.

How can the study of all3971 contribute to our broader understanding of zinc metalloproteases in cyanobacteria?

The study of all3971 can significantly advance our understanding of zinc metalloproteases in cyanobacteria through several key contributions:

• Evolutionary insights: Detailed characterization of all3971 allows for comparative analysis with metalloproteases from diverse cyanobacterial lineages, revealing evolutionary patterns and adaptations. This can illuminate how these enzymes have evolved in response to different ecological niches and potentially identify horizontal gene transfer events.

• Structure-function relationships: Elucidating the three-dimensional structure of all3971 and correlating structural features with enzymatic properties would establish fundamental principles applicable to the broader class of cyanobacterial zinc metalloproteases. This would enhance our ability to predict functions from sequence data alone.

• Regulatory networks: Investigating the regulation of all3971 expression and activity can reveal how metalloproteases are integrated into cellular signaling networks in cyanobacteria, potentially uncovering conserved regulatory mechanisms across different species.

• Role in secondary metabolism: Nostoc species are prolific producers of bioactive secondary metabolites . Understanding if and how all3971 participates in secondary metabolite biosynthesis or modification could reveal previously unrecognized roles for metalloproteases in natural product biosynthesis across cyanobacteria.

• Environmental adaptations: Characterizing how all3971 activity responds to environmental factors (temperature, pH, salinity, light) can provide insights into how cyanobacteria use proteolytic systems to adapt to diverse and changing environments, a critical aspect of their global ecological success.

• Biotechnological applications: Insights gained from all3971 could inform the development of cyanobacterial zinc metalloproteases as biotechnological tools, potentially revealing unique properties that distinguish them from better-studied bacterial and eukaryotic metalloproteases.

• Biofilm and community dynamics: Understanding all3971's potential role in biofilm formation and maintenance could illuminate general principles of how metalloproteases contribute to the social behaviors and community structures of cyanobacteria.

This multifaceted approach to studying all3971 would not only characterize one specific enzyme but would also contribute significantly to our fundamental understanding of proteolytic systems in this ancient and ecologically important bacterial phylum.

What are the most important primary research papers and resources for researchers beginning work with all3971?

Researchers beginning work with Recombinant Nostoc sp. Putative zinc metalloprotease all3971 should familiarize themselves with the following key resources:

• Protein databases and repositories:

  • UniProt entry Q8YQ64 containing sequence data, predicted features, and cross-references for all3971

  • Protein Data Bank (PDB) for structures of related zinc metalloproteases that can guide homology modeling

  • MEROPS database for comprehensive classification and information on proteases and their inhibitors

• Methodological papers for zinc metalloprotease characterization:

  • Protocols for activity assays using azocasein, azocoll, and insoluble casein as substrates

  • Methods for inhibition studies using ortho-phenanthroline, Zincov, and other metalloprotease inhibitors

  • Purification strategies including ammonium sulfate precipitation, gel filtration chromatography, and hydrophobic interaction chromatography

• Comparative studies on cyanobacterial proteases:

  • Research on zinc-containing metalloproteases from other cyanobacteria, particularly those with characterized functions and properties

  • Studies on the ecological and physiological roles of proteases in Nostoc species and related cyanobacteria

• Resources for genetic manipulation of Nostoc:

  • Protocols for gene disruption and complementation in Nostoc sp. PCC 7120

  • Expression systems optimized for cyanobacterial proteins

  • Genomic context information for all3971 in the Nostoc sp. PCC 7120 genome

• Commercial sources of recombinant all3971:

  • Suppliers of purified recombinant protein for use as positive controls or standards

  • Sources of expression constructs or gene synthesis services for custom production

• Specialized analytical techniques:

  • Protocols for metalloprotease-specific activity-based protein profiling (ABPP)

  • Mass spectrometry methods for identifying cleavage sites and protein-protein interactions

• Bioinformatic tools:

  • Servers for protein structure prediction (AlphaFold, I-TASSER)

  • Tools for identifying conserved domains and motifs in metalloproteases

  • Software for analyzing substrate specificity based on sequence analysis