Recombinant Nostoc sp. UPF0187 protein alr2987 (alr2987)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
alr2987; UPF0187 protein alr2987
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
alr2987
Target Protein Sequence
MTVAKKHWFQIAFQLRGSVIGAIYKRVICCALFGVLVTLLYQLKIPVSQPILGSVIPSIV LGLLLVFRTNTAYDRFWEGRKAWGSIVNNTRNLARQIWVSVEEVSLKDREAKISVLNLLV AFAVATKLHLRGEPINSELEDLISTSRYFKLKSMNNPPLEVAFWIGDYLQQQYTCKCLNS YQLTSIQELLNNLVDNLGSCERILRTPMPLAYSIHLKQLLLLYCFLLPFQMVESLGWWTG LVVGLVSFTLFGIEAIGLEIENPFGYDPNDLPLDAICNTMKRNIDDLTSLSPNVRSHDLG ETSNVTI
Uniprot No.

Target Background

Database Links

KEGG: ana:alr2987

STRING: 103690.alr2987

Protein Families
UPF0187 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Recombinant Nostoc sp. UPF0187 protein alr2987?

Recombinant Nostoc sp. UPF0187 protein alr2987 is a full-length protein (307 amino acids) derived from the cyanobacterium Nostoc sp. It belongs to the UPF0187 protein family, which is a group of uncharacterized proteins. The recombinant form typically includes an N-terminal His-tag to facilitate purification and is expressed in E. coli expression systems . The protein has the UniProt ID Q8YSU5, which allows researchers to access additional sequence and structural information through protein databases .

What are the optimal storage conditions for the recombinant alr2987 protein?

The recombinant protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple uses to prevent protein degradation. Repeated freeze-thaw cycles should be avoided to maintain protein integrity and activity. For working aliquots, storage at 4°C for up to one week is recommended . The protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during storage .

What expression systems are most effective for producing recombinant alr2987?

E. coli is the predominant expression system used for recombinant alr2987 production, as evidenced by commercial preparations . When establishing an expression protocol, researchers should consider:

  • Optimal codon usage for E. coli

  • Selection of appropriate promoter systems

  • Induction conditions (temperature, IPTG concentration)

  • Cell lysis methods that preserve protein structure

While E. coli is common, other expression systems might be explored for specific research questions, particularly if post-translational modifications are suspected to be important for function.

How should the recombinant alr2987 protein be reconstituted for experimental use?

For optimal reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (commonly 50%) for long-term storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

This methodological approach ensures maximum retention of protein activity and structural integrity for downstream applications.

What structural characteristics define the UPF0187 protein family to which alr2987 belongs?

While specific structural data for alr2987 is limited in the provided search results, comparative analysis with other cyanobacterial proteins suggests potential membrane-associated functions. The sequence contains regions indicative of transmembrane domains, particularly in the N-terminal portion with hydrophobic stretches . Drawing parallels from related Nostoc proteins, secondary structure analysis would likely reveal a combination of alpha-helical and beta-sheet elements, particularly when examining the ice-binding proteins (IBPs) from Nostoc sp., which show typical profiles rich in beta-sheet structures with negative circular dichroism bands at ~212 nm and positive ellipticity at ~195 nm .

How does alr2987 compare to ice-binding proteins found in Nostoc species?

While alr2987 is not specifically identified as an ice-binding protein (IBP), research on other Nostoc proteins provides relevant comparative context. Nostoc IBPs:

  • Demonstrate strong ice-structuring activities

  • Often contain DUF3494 domains

  • May feature PEP C-terminal signals associated with anchoring to the outer cell membrane

  • Show characteristic circular dichroism spectra consistent with beta-sheet-rich structures

  • May have been acquired through horizontal gene transfer

Further studies would be required to determine if alr2987 shares any functional similarities with these ice-binding proteins or serves entirely different cellular functions.

What analytical techniques are most informative for studying alr2987 structure and function?

Based on approaches used with similar proteins, the following techniques would likely yield valuable insights:

  • Circular Dichroism (CD) Spectroscopy: To analyze secondary structure elements and thermal stability, as demonstrated with recombinant Nostoc IBPs that showed distinct profiles rich in beta-sheet structures with transition midpoints around 47.9±0.7°C

  • SDS-PAGE Analysis: For confirming protein purity, molecular weight, and expression efficiency

  • Mass Spectrometry: For accurate molecular weight determination and identification of potential post-translational modifications

  • Functional Assays: Design specific to hypothesized function, potentially including membrane association tests if transmembrane domains are confirmed

How can researchers effectively design experiments to elucidate the biological role of alr2987?

A comprehensive experimental approach might include:

  • Gene Knockout/Knockdown Studies: Create Nostoc sp. strains with altered alr2987 expression to observe phenotypic changes under various growth conditions

  • Protein Localization: Use fluorescent tags or immunolocalization to determine the subcellular localization of alr2987, paying particular attention to potential membrane association

  • Interactome Analysis: Perform pull-down assays or yeast two-hybrid screening to identify interaction partners

  • Comparative Genomics: Analyze distribution and conservation of alr2987 across cyanobacterial species, which may provide clues about its evolutionary importance and function

  • Growth Condition Variation: Test protein expression levels under different environmental stressors similar to those used in studies of spore formation in Nostoc, such as nitrogen depletion

What methodological approaches can address the challenge of functional annotation for uncharacterized proteins like alr2987?

For UPF (Uncharacterized Protein Family) members like alr2987, researchers should consider:

  • Integrated Omics Approaches: Combine transcriptomics, proteomics, and metabolomics to identify conditions where alr2987 expression changes significantly

  • Structural Prediction and Modeling: Utilize advanced computational tools like AlphaFold2 to predict protein structure, followed by in silico docking studies to hypothesize binding partners or substrates

  • Evolutionary Analysis: Perform detailed phylogenetic analyses to identify related proteins with known functions, potentially revealing functional conservation

  • High-throughput Screening: Design assays to test multiple potential functions in parallel, particularly focused on cyanobacterial-specific metabolic pathways

How might environmental factors influence alr2987 expression and function in Nostoc sp.?

While specific data on alr2987 regulation is not directly provided, research on Nostoc sp. growth conditions provides relevant context for experimental design:

  • Nutrient Availability: Nitrogen depletion is known to trigger significant physiological changes in Nostoc sp., including the formation of resting spores . Experiments could test whether alr2987 expression changes under nitrogen limitation or other nutrient stress conditions.

  • Temperature Adaptation: Given that some Nostoc species possess ice-binding proteins for cold adaptation , researchers should investigate whether alr2987 expression is temperature-dependent, particularly in response to cold stress.

  • Cell Density Effects: Studies on Nostoc species have employed controlled cell density experiments with conditioned media to study cellular responses . Similar approaches could help determine if alr2987 plays a role in quorum sensing or other density-dependent phenomena.

What are the methodological challenges in distinguishing between endogenous and exogenous protein functions in Nostoc communities?

Research on Nostoc ice-binding proteins revealed that observed protein activity was due to a combination of endogenous and exogenous sources . When studying alr2987, researchers should:

  • Use highly purified or axenic cultures when possible

  • Consider metagenomic approaches to identify potential sources of similar proteins

  • Implement rigorous controls to distinguish between proteins produced by Nostoc and those from associated microorganisms

  • Employ protein-specific antibodies or tagged constructs to confirm the source of detected activity

What theoretical models best explain the evolutionary history of UPF0187 family proteins in cyanobacteria?

While direct evolutionary data for alr2987 is limited, research on other Nostoc proteins suggests that horizontal gene transfer may play an important role in functional protein acquisition . Researchers investigating alr2987 should:

  • Conduct comprehensive phylogenetic analyses across diverse cyanobacterial genomes

  • Examine genomic context for evidence of recent gene transfer events

  • Compare nucleotide composition and codon usage patterns with the rest of the Nostoc genome

  • Investigate the presence of mobile genetic elements near the alr2987 locus

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.