Recombinant Nostoc sp. Ycf92-like protein (alr0484)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

The Ycf92-like protein encoded by the alr0484 gene is a 308-amino-acid polypeptide (UniProt ID: Q8YZH6) with a predicted molecular weight of ~34 kDa . While its exact physiological role remains under investigation, homologs of Ycf92 are implicated in:

  • Photosystem stabilization: Based on conserved domain analysis of related cyanobacterial proteins .

  • Heterocyst development: Indirectly linked via interactions with nitrogen-stress-induced RNAs (e.g., NsiR1) .

  • DNA repair pathways: Co-expressed with RecF/O/R proteins involved in double-strand break repair .

Recombinant Production Systems

Commercial and research-grade variants are produced using multiple expression platforms:

Comparative Production Methods :

Host SystemPurityTagYield (mg/L)Application
E. coli≥85%His-tag2.5–3.2ELISA, WB
Yeast≥90%None1.8–2.1Structural studies
Cell-Free Expression≥80%GST-tag0.5–1.0Functional assays

Purification: Typically involves immobilized metal affinity chromatography (IMAC) followed by size-exclusion chromatography .

3.1. Heterocyst Differentiation Studies

  • Mechanistic role: NsiR1, a small RNA antisense to hetF (a heterocyst regulator), binds the 5' UTR of hetF mRNA, modulating translation . Recombinant alr0484 is hypothesized to interact with RNA-binding proteins in this pathway.

  • Phenotypic effects: Overexpression of alr0484 correlates with delayed heterocyst maturation and enlarged cell size in Nostoc mutants .

3.2. DNA Repair Pathways

  • RecF/O/R interactions: Co-expression profiling shows alr0484 transcripts increase under UV stress, paralleling RecF/O/R protein levels .

  • Functional assays: Recombinant alr0484 enhances in vitro RecR-mediated DNA strand annealing by 40% .

3.3. Biotechnological Potential

  • Photosynthetic engineering: Tested in synthetic chloroplast systems to stabilize light-harvesting complexes .

  • Biofilm modulation: Preliminary data suggest it influences exopolysaccharide production in cyanobacterial mats .

Unresolved Questions and Future Directions

  • Structural elucidation: No X-ray crystallography or cryo-EM data available yet.

  • Metabolic linkages: Potential role in terpenoid biosynthesis clusters (e.g., tolypodiols) .

  • Human health relevance: Homologs in Nostoc commune exhibit anti-inflammatory properties , suggesting unexplored therapeutic avenues.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage state, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
alr0484; Ycf92-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Target Names
alr0484
Target Protein Sequence
MDLLRSLPLGLYLEQPQTWLHKLDPRVKFIWLMSFLTSYSFANNLWRILLVALLILFTLI ARIPRRVWQQQMGWLLTLSFFVLAIAAISPDGLGVDYQSRLPTNPQVLTQSANTNNSATA TEQLKSSKSYTYVLFHKGPVKVTRRSLDLAVRISTIIFTVIYSTNLYLLTTAPEEITAGV ESLMQPLRRFKIPVTEITLTLTLSLRFIPLVLEEVQNLVRSVMTRAINWKKLGLKGAVKV WMIVAERLLENLLLRASQMASAMMVRGFTSPNEHRVPWHDLRLKLRDWLAIASLTIFWGI RVVFGNQI
Uniprot No.

Target Background

Database Links

KEGG: ana:alr0484

STRING: 103690.alr0484

Protein Families
Ycf92 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Ycf92-like protein (alr0484) and what organism does it originate from?

Ycf92-like protein (alr0484) is a hypothetical protein encoded by the alr0484 gene in the cyanobacterium Nostoc sp. (strain PCC 7120 / UTEX 2576) . This protein has Uniprot accession number Q8YZH6 and consists of 308 amino acids . In the genome of Nostoc sp. strain PCC 7120 (also known as Anabaena sp. PCC 7120), alr0484 is located adjacent to asr0485 (which encodes the PipX protein) and is part of a gene cluster that includes alr0486 . The function of alr0484 has not been fully characterized, though its genomic context suggests potential involvement in nitrogen metabolism regulation pathways, given its proximity to the PipX-encoding gene, which is known to be involved in nitrogen control in cyanobacteria .

What expression systems are most effective for recombinant production of Ycf92-like protein (alr0484)?

Several expression systems can be used for the recombinant production of Ycf92-like protein (alr0484), each with distinct advantages depending on research objectives:

Expression SystemAdvantagesRecommended For
E. coliHighest yields, shortest production time, cost-effective, established protocolsInitial characterization, functional studies requiring large amounts of protein
YeastGood yields, some post-translational modifications, relatively quick productionStudies requiring eukaryotic processing without complex glycosylation
Insect cells with baculovirusMore extensive post-translational modifications, proper folding of complex proteinsStructural studies, functional assays where protein conformation is critical
Mammalian cellsMost complete post-translational modifications, native-like protein foldingStudies requiring authentic protein structure and modifications

How can researchers optimize purification of recombinant Ycf92-like protein (alr0484)?

For optimal purification of recombinant Ycf92-like protein (alr0484), researchers should consider the following methodology:

  • Fusion Tag Selection: Multiple tags can be used including His Tag, FLAG Tag, MBP, GST, trxA, Nus, Biotin, or GFP . His-tag is commonly used for initial purification due to its small size and minimal interference with protein function.

  • Purification Protocol:

    • For His-tagged protein: Use immobilized metal affinity chromatography (IMAC) with a HisTrap HP column

    • Follow with size-exclusion chromatography using a Superdex 75 column

    • Recommended buffer: 50 mM Tris–HCl, pH 7.5, 300 mM NaCl, and 5% glycerol

  • Post-purification Processing: Consider protein renaturation, endotoxin removal, filtration sterilization, and lyophilization based on experimental requirements .

  • Storage Conditions: Store in Tris-based buffer with 50% glycerol at -20°C for regular use, or at -80°C for extended storage . Avoid repeated freezing and thawing; prepare working aliquots and store at 4°C for up to one week .

What methods are recommended for functional characterization of Ycf92-like protein (alr0484)?

For comprehensive functional characterization of Ycf92-like protein (alr0484), researchers should implement a multi-faceted approach:

How can researchers design effective mutagenesis studies for Ycf92-like protein (alr0484)?

When designing mutagenesis studies for Ycf92-like protein (alr0484), consider this methodological framework:

  • Sequence-based Targeting:

    • Perform bioinformatic analysis to identify conserved residues across homologous proteins

    • Focus on predicted functional domains using tools like Pfam, PROSITE, and InterPro

    • Target hydrophobic residues that might be involved in protein-protein interactions

  • Structure-guided Mutagenesis: While a crystal structure for alr0484 is not available in the search results, researchers can:

    • Generate homology models based on related proteins

    • Use computational protein design approaches like those described in search result

    • Focus on novel structural features, particularly at interfaces between secondary structures

  • Systematic Mutagenesis Protocol:

    • Design primers with appropriate restriction sites for site-directed mutagenesis

    • Clone into expression vectors like pET28a following similar methodology to that used for ycfD

    • Express mutant proteins using the optimized expression system

    • Perform comparative functional assays between wild-type and mutant proteins

  • Validation Experiments:

    • Circular dichroism to confirm proper folding of mutant proteins

    • Size exclusion chromatography to assess oligomerization state

    • Thermal stability assays to determine if mutations affect protein stability

    • Specific functional assays based on hypothesized protein function

What experimental approaches can determine the potential role of Ycf92-like protein (alr0484) in nitrogen metabolism?

Based on its genomic proximity to the PipX-encoding gene (asr0485), which is involved in nitrogen control, researchers might investigate alr0484's potential role in nitrogen metabolism through:

  • Comparative Growth Analysis:

    • Culture wild-type and alr0484 knockout strains under various nitrogen conditions (ammonium, nitrate, and diazotrophic conditions)

    • Monitor growth rates, chlorophyll content, and heterocyst formation

    • Compare with phenotypes of known nitrogen metabolism mutants (ntcA, hetR, and pipX)

  • Transcriptional Regulation Studies:

    • Perform quantitative RT-PCR to analyze expression patterns of alr0484 under different nitrogen conditions

    • Use primer extension and 5' RACE to identify transcription start points (TSPs)

    • Determine if alr0484 expression is regulated by nitrogen-responsive transcription factors like NtcA

  • Metabolomic Analysis:

    • Compare metabolite profiles between wild-type and alr0484 mutant strains

    • Focus on nitrogen-containing metabolites and intermediate compounds in nitrogen assimilation pathways

    • Use stable isotope labeling to track nitrogen flux

  • Biochemical Interaction Tests:

    • Test for direct interaction with PipX and other nitrogen regulatory proteins

    • Investigate potential enzymatic activity using purified recombinant protein

    • Examine post-translational modifications under different nitrogen conditions

What are the challenges and solutions in structural studies of Ycf92-like protein (alr0484)?

Structural characterization of Ycf92-like protein (alr0484) presents several challenges with corresponding methodological solutions:

ChallengeSolution ApproachMethodological Details
Protein solubilityFusion tag optimizationTest multiple fusion tags (MBP, GST, SUMO) to enhance solubility; consider expressing as fragments rather than full-length protein
Crystallization difficultiesAlternative structural methodsEmploy small-angle X-ray scattering (SAXS), nuclear magnetic resonance (NMR) for smaller domains, or cryo-electron microscopy
Conformational heterogeneityProtein engineeringDesign conformationally restricted variants through disulfide engineering or use computational design with learned potentials to improve stability
Membrane associationDetergent screeningTest various detergents for solubilization; consider nanodiscs or amphipols for maintaining native-like environment
Low expression yieldsExpression system optimizationCompare yields across multiple systems; optimize codon usage for expression host; consider using synthetic genes with optimized sequences
Limited functional insightsHybrid structural approachesCombine low-resolution structural data with computational modeling and evolutionary sequence analysis to derive functional hypotheses

How can transcriptomic data inform research on Ycf92-like protein (alr0484) function?

Transcriptomic analysis can provide valuable insights into the function of Ycf92-like protein (alr0484) through:

  • Co-expression Network Analysis:

    • Identify genes with similar expression patterns across various conditions

    • Construct gene co-expression networks to place alr0484 in functional modules

    • Compare expression patterns with known nitrogen metabolism genes

  • Differential Expression Studies:

    • Analyze RNA-seq data from wild-type Nostoc sp. under various conditions (particularly nitrogen availability)

    • Compare with mutant strains (ntcA, hetR) to identify regulatory relationships

    • Design Northern blot experiments similar to those used for pipX to validate expression patterns:

      • Extract RNA from filaments grown with ammonium and incubated in the absence of combined nitrogen

      • Use probes specific to alr0484 to detect transcript abundance changes

      • Compare patterns with those observed for pipX and nearby genes

  • Transcript Architecture Determination:

    • Use approaches similar to those described in search result :

      • RT-PCR with distinct primers for retrotranscription

      • Different primer pairs for PCR to determine transcriptional units

      • 5' RACE analysis with TAP treatment to distinguish primary transcripts from processed RNAs

  • Integration with Other Data Types:

    • Correlate expression patterns with metabolomic changes

    • Relate to proteomics data to identify post-transcriptional regulation

    • Connect to phenotypic observations under corresponding conditions

How should researchers design experiments to investigate potential interactions between Ycf92-like protein (alr0484) and PipX?

Given the genomic proximity of alr0484 to the pipX gene (asr0485), investigating their potential interactions requires a carefully designed experimental approach:

  • In Vitro Binding Assays:

    • Express and purify both proteins with different tags (His-tag for one, GST-tag for the other)

    • Perform pull-down assays under various conditions (different pH, salt concentrations)

    • Use surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to quantify binding kinetics and thermodynamics

  • In Vivo Interaction Studies:

    • Bacterial two-hybrid system adapted for cyanobacteria

    • Co-immunoprecipitation from Nostoc sp. cell lysates

    • Fluorescence resonance energy transfer (FRET) using fluorescent protein fusions

  • Genetic Interaction Analysis:

    • Generate single and double knockout mutants (Δalr0484, ΔpipX, and Δalr0484/ΔpipX)

    • Compare phenotypes under different nitrogen conditions

    • Analyze epistatic relationships to determine functional pathway positions

  • Structural Studies of the Complex:

    • Attempt co-crystallization of both proteins

    • Use protein-protein docking algorithms if individual structures are available

    • Consider crosslinking mass spectrometry to identify interaction surfaces

What considerations are important when designing expression constructs for Ycf92-like protein (alr0484) structural studies?

For structural studies of Ycf92-like protein (alr0484), expression construct design should address several key considerations:

  • Construct Optimization Strategy:

    • Design multiple constructs with varying N- and C-terminal boundaries

    • Consider secondary structure predictions to avoid truncating within structured elements

    • Include TEV protease sites for tag removal to minimize structural interference

  • Tag Position and Selection:

    • Test both N-terminal and C-terminal tag positions

    • Consider small tags (His) for initial screening and larger solubility-enhancing tags (MBP, GST) for problematic constructs

    • For crystallography, ensure tag removal options without adding non-native residues

  • Expression Vector Considerations:

    • Select vectors with appropriate promoters (T7 for high expression in E. coli)

    • Consider vectors with rare codon supplementation for cyanobacterial genes

    • Incorporate options for selenomethionine labeling for crystallographic phasing

  • Model System Selection:

    • Consider the approach used for ycfD protein from Rhodothermus marinus:

      • Amplification from genomic DNA using specific primers

      • Initial cloning into pGEMT-Easy vector

      • Subcloning into expression vector (e.g., pET28a) using appropriate restriction sites

  • Expression Screening Protocol:

    • Test multiple expression conditions (temperature, induction time, inducer concentration)

    • Screen for solubility using small-scale purifications

    • Evaluate protein stability and homogeneity by size-exclusion chromatography

How can researchers address poor solubility when working with recombinant Ycf92-like protein (alr0484)?

Poor solubility is a common challenge when working with recombinant proteins. For Ycf92-like protein (alr0484), consider these methodological solutions:

  • Fusion Partner Strategies:

    • Test multiple solubility-enhancing tags: MBP, GST, SUMO, TrxA, or NusA

    • Consider the position of the tag (N-terminal vs. C-terminal) based on predicted structure

    • Evaluate tag removal effects on solubility before proceeding to functional studies

  • Expression Condition Optimization:

    • Lower induction temperature (16-20°C) to slow folding and prevent aggregation

    • Reduce inducer concentration for slower, more controlled expression

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J) to assist folding

  • Buffer Optimization Matrix:

    VariableOptions to Test
    pH6.0, 6.5, 7.0, 7.5, 8.0
    Salt concentration100, 300, 500 mM NaCl
    Additives5-10% glycerol, 0.1-0.5% non-ionic detergents, 1-5 mM reducing agents
    Stabilizing agentsAmino acids (arginine, glutamate), osmolytes (sucrose, trehalose)
  • Protein Engineering Approach:

    • Identify and mutate surface hydrophobic residues to hydrophilic ones

    • Remove predicted disordered regions that might promote aggregation

    • Consider the computational protein design approaches mentioned in search result to improve stability

  • Refolding Protocols:

    • Express as inclusion bodies and develop a refolding protocol

    • Use gradual dialysis or rapid dilution methods

    • Incorporate the protein renaturation service mentioned in search result

What approaches can resolve inconsistent activity in functional assays of Ycf92-like protein (alr0484)?

When facing inconsistent activity in functional assays, researchers should systematically investigate:

  • Protein Quality Assessment:

    • Verify protein integrity by SDS-PAGE and mass spectrometry

    • Assess proper folding using circular dichroism spectroscopy

    • Check for batch-to-batch consistency using size-exclusion chromatography

  • Assay Optimization Strategy:

    • Determine optimal protein concentration range through titration experiments

    • Test different buffer compositions and pH values

    • Evaluate the effect of potential cofactors or binding partners (including PipX)

  • Stability Considerations:

    • Monitor activity decay over time under assay conditions

    • Add stabilizing agents like glycerol or reducing agents if appropriate

    • Prepare fresh protein aliquots for each experiment to avoid freeze-thaw cycles

  • Controls and Validation:

    • Include positive and negative controls in every assay

    • Design inactive mutants (based on sequence conservation) as negative controls

    • Validate activity using complementary assay formats

  • Data Analysis Approach:

    • Use statistical methods to distinguish significant activity from background

    • Account for day-to-day variability through normalization

    • Consider Bayesian analysis for complex datasets with multiple variables

How might advanced computational approaches enhance understanding of Ycf92-like protein (alr0484) function?

Computational approaches offer powerful tools for investigating Ycf92-like protein (alr0484) function:

  • Advanced Structural Prediction:

    • Apply AlphaFold2 or RoseTTAFold for high-confidence structure prediction

    • Use learned potential approaches similar to those described in search result

    • Incorporate experimental constraints from limited proteolysis or crosslinking data

  • Evolutionary Analysis:

    • Conduct comprehensive phylogenetic analysis of Ycf92-like proteins across cyanobacteria

    • Identify co-evolving residues to predict functional sites

    • Analyze selective pressure patterns to identify functionally important regions

  • Systems Biology Integration:

    • Construct genome-scale metabolic models incorporating alr0484

    • Simulate nitrogen metabolism with and without functional alr0484

    • Predict phenotypic consequences of alr0484 perturbation

  • Molecular Dynamics Simulations:

    • Model protein dynamics and conformational changes

    • Investigate potential binding sites through virtual screening

    • Simulate interactions with predicted partners like PipX

  • Machine Learning Applications:

    • Develop models to predict protein-protein interactions involving alr0484

    • Use text mining to extract functional hypotheses from literature

    • Apply transfer learning from characterized homologs to predict function

What emerging technologies could advance research on Ycf92-like protein (alr0484)?

Several cutting-edge technologies could significantly advance research on Ycf92-like protein (alr0484):

  • Cryo-Electron Microscopy:

    • Single-particle analysis for high-resolution structural determination

    • Visualize complexes with interaction partners

    • Examine conformational heterogeneity

  • Proximity Labeling Proteomics:

    • Use BioID or APEX2 fusions to identify proximal proteins in vivo

    • Map the local interactome under different nitrogen conditions

    • Discover previously unknown interaction partners

  • CRISPRi/CRISPRa Systems for Cyanobacteria:

    • Develop inducible knockdown/overexpression systems

    • Create graded expression levels to study dosage effects

    • Target multiple genes simultaneously to study genetic interactions

  • Single-Cell Techniques:

    • Apply single-cell RNA-seq to study cell-type specific expression

    • Use time-lapse fluorescence microscopy with tagged proteins

    • Investigate potential heterogeneity in expression across filaments

  • Protein Engineering and Design:

    • Apply computational design principles described in search result

    • Create synthetic variants with enhanced stability or novel functions

    • Develop biosensors based on alr0484 for monitoring nitrogen metabolism

By applying these advanced approaches, researchers can develop a more comprehensive understanding of the structure, function, and biological significance of Ycf92-like protein (alr0484) in cyanobacterial metabolism and adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.