Recombinant Nothoprocta perdicaria Cytochrome c oxidase subunit 2 (MT-CO2), partial

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
partial
Species
Nothoprocta perdicaria (Chilean tinamou) (Crypturus perdicarius)
Target Names
Target Protein Sequence
AICSLVLYLLALMLMEKLSSNTVDAQEVELIWTILPAIVLILLALPSLQILYMMDEIDEP DLTLKAIGHQWYWSYEYTDFKDLSFDSYMIPTTELPSGHFRLLEVDHRVVVPTESPIRVI VTAGDVLHSWAVPTLGVKTDAIPGRLNQTSFITTRPGIFYGQCSEICGANHSYMPIVVES TPLPYFESWSTLLSTSSL
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain, comprising succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase, facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (subunit 2) and heme A (subunit 1) to the binuclear center (BNC) in subunit 1. The BNC, composed of heme A3 and CuB, reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 and what is its primary function?

Cytochrome c oxidase subunit 2 (MT-CO2) is a critical component of Complex IV in the mitochondrial electron transport chain. This protein forms part of the catalytic core of cytochrome c oxidase (CcO), the terminal enzyme in the respiratory chain that reduces molecular oxygen to water while pumping protons across the inner mitochondrial membrane . In Nothoprocta perdicaria (Chilean tinamou), MT-CO2 is encoded by the mitochondrial genome and plays an essential role in cellular respiration.

The protein functions within a larger complex consisting of multiple subunits. In yeast, for example, the complete CcO complex contains 11 subunits with three (including Cox2) encoded by mitochondrial DNA and eight by nuclear DNA . MT-CO2 contains copper centers that are crucial for electron transfer from cytochrome c to the catalytic site where oxygen reduction occurs. This makes it essential for ATP production through oxidative phosphorylation.

What are the optimal storage and handling conditions for recombinant MT-CO2?

Recombinant Nothoprocta perdicaria MT-CO2 requires specific storage and handling conditions to maintain structural integrity and functionality. Research-grade recombinant protein is typically stored in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein .

For short-term storage (up to one week), working aliquots can be maintained at 4°C. For longer-term storage, the protein should be kept at -20°C, while extended preservation requires storage at -20°C or -80°C . Crucially, repeated freeze-thaw cycles significantly compromise protein integrity and should be avoided. A methodological approach involves:

  • Upon receipt, briefly centrifuge the protein vial to collect content at the bottom

  • Prepare small working aliquots in sterile microcentrifuge tubes

  • Flash-freeze aliquots in liquid nitrogen before transferring to -80°C

  • When using, thaw a single aliquot on ice and keep at 4°C if using within a week

This approach minimizes protein degradation and maintains the catalytic properties required for experimental applications.

How can recombinant MT-CO2 be used in evolutionary biology studies?

Recombinant Nothoprocta perdicaria MT-CO2 provides a valuable tool for evolutionary biology studies, particularly for investigating the evolution of mitochondrial proteins. As a mitochondrially-encoded protein that is highly conserved across species, MT-CO2 sequence analysis can illuminate evolutionary relationships and adaptive changes.

A methodological framework for such studies includes:

StepMethodologyAnalytical Approach
1Sequence alignment of MT-CO2 across avian speciesMultiple sequence alignment using MUSCLE or CLUSTAL
2Identification of conserved vs. variable regionsConservation analysis and entropy calculations
3Selection pressure analysisdN/dS ratio calculation across codons
4Structure-function correlationMapping variations to 3D protein structure
5Ecological correlationAssociation of variations with habitat/behavioral traits

Researchers can employ recombinant MT-CO2 to validate computational findings through functional assays that measure electron transfer efficiency or oxygen consumption rates under varying conditions. This approach has revealed that despite sequence variations across species, the core functional domains remain highly conserved, reflecting the essential nature of cytochrome c oxidase in aerobic metabolism .

What experimental approaches can determine the effects of point mutations on MT-CO2 function?

Point mutations in MT-CO2 can significantly impact protein function, as demonstrated by the W56R mutation studies in yeast Cox2 . To systematically assess the effects of point mutations in Nothoprocta perdicaria MT-CO2, researchers can employ the following experimental pipeline:

  • Site-directed mutagenesis to introduce specific amino acid substitutions

  • Expression of wild-type and mutant proteins in suitable host systems

  • Purification and biochemical characterization

  • Functional assays including:

    • Oxygen consumption measurements (Clark electrode or high-resolution respirometry)

    • Spectroscopic analysis of cytochrome redox state

    • In-gel activity assays for assembled complexes

Research has shown that mutations affecting hydrophobicity in transmembrane regions, such as the W56R mutation in yeast Cox2, can impact protein import into mitochondria without necessarily affecting enzymatic function once properly assembled . The experimental evidence from yeast models showed that while a W56R mutation allowed cytosol-synthesized Cox2 to be imported into mitochondria, wild-type mtCox2 and mutant mtCox2 W56R both exhibited comparable activity and supercomplex formation when encoded in the mitochondrial genome .

This comparative approach allows researchers to distinguish between effects on:

  • Protein targeting and import

  • Protein folding and assembly

  • Catalytic activity

  • Supercomplex formation and stability

How does the structure-function relationship in MT-CO2 compare between avian and mammalian species?

The structure-function relationship in MT-CO2 between avian species like Nothoprocta perdicaria and mammals reveals both conserved features and adaptive differences. Comparative analysis requires:

  • Structural alignment of avian and mammalian MT-CO2 proteins

  • Identification of species-specific substitutions

  • Functional characterization of these differences

A comparative data table of key structural features:

FeatureAvian MT-CO2 (e.g., N. perdicaria)Mammalian MT-CO2Functional Implication
Cu binding sitesConserved His-X-X-X-His motifConserved His-X-X-X-His motifEssential for electron transfer
Transmembrane helicesTwo primary helicesTwo primary helicesMembrane anchoring preserved
Cytochrome c interaction sitesSlightly more polar residuesMore hydrophobic interaction surfaceMay affect binding kinetics
C-terminal domainMore variableMore conservedSpecies-specific regulation

Methodologically, researchers can use recombinant proteins from both avian and mammalian species to perform cross-species complementation studies. These experiments can determine whether avian MT-CO2 can functionally integrate into mammalian CcO complexes and vice versa. Such studies have practical applications in understanding species-specific adaptations to different metabolic demands and oxygen environments.

What are the optimal protocols for incorporating recombinant MT-CO2 into functional assays?

Incorporating recombinant Nothoprocta perdicaria MT-CO2 into functional assays requires specific methodological considerations. The following protocol has been optimized based on research approaches in the field:

  • Reconstitution of purified recombinant MT-CO2:

    • Dilute the glycerol stock to working concentration (typically 0.1-1.0 μg/μL) in buffer containing 20 mM HEPES (pH 7.4), 100 mM KCl, and 1 mM EDTA

    • Add phospholipids (typically a mixture of cardiolipin, phosphatidylcholine, and phosphatidylethanolamine) at a lipid:protein ratio of 40:1

    • Perform dialysis to remove detergent and allow proteoliposome formation

  • Cytochrome c oxidase activity assay:

    • Prepare reaction mixture containing 50 mM phosphate buffer (pH 7.4), 50 μM reduced cytochrome c

    • Add proteoliposomes containing MT-CO2 (either alone or reconstituted with other subunits)

    • Monitor the oxidation of cytochrome c by measuring absorbance decrease at 550 nm

    • Calculate activity as the first-order rate constant of cytochrome c oxidation

  • Oxygen consumption measurements:

    • Use a Clark-type electrode or high-resolution respirometry

    • Experimental conditions should include 25°C in buffer containing 10 mM HEPES (pH 7.4), 125 mM KCl

    • Add substrates sequentially: typically NADH, succinate, and finally ascorbate/TMPD for direct CcO activity

    • Quantify oxygen consumption rates normalized to protein content

Research has demonstrated that these functional assays can effectively distinguish between wild-type and mutant proteins, with studies in yeast showing significant differences in oxygen consumption between strains with different versions of Cox2 .

How can researchers optimize expression and purification of recombinant MT-CO2 for structural studies?

Optimizing expression and purification of recombinant Nothoprocta perdicaria MT-CO2 for structural studies presents unique challenges due to its hydrophobic transmembrane domains. A comprehensive methodological approach includes:

  • Expression system selection:

    • Prokaryotic systems: Modified E. coli strains (C41/C43) designed for membrane protein expression

    • Eukaryotic systems: Yeast (P. pastoris) or insect cells (Sf9) for proper post-translational modifications

    • Cell-free systems: For difficult-to-express constructs

  • Construct design considerations:

    • Addition of purification tags (His6, GST, or FLAG) at N or C-terminus

    • Inclusion of cleavable tags that can be removed after purification

    • Potential modification of highly hydrophobic regions that impede expression

  • Solubilization and purification strategy:

    • Initial solubilization in mild detergents (DDM, LMNG, or digitonin)

    • Two-step purification using affinity chromatography followed by size exclusion

    • Buffer optimization to maintain protein stability

  • Quality control assessment:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Circular dichroism to assess secondary structure

    • Activity assays to confirm functional integrity

For structural studies specifically, researchers should consider:

Structural MethodSample RequirementsOptimization Strategies
X-ray CrystallographyHigh purity (>95%), homogeneity, stability in detergentScreening multiple detergents, addition of lipids, use of antibody fragments
Cryo-EMModerate concentration (1-5 mg/mL), minimal aggregationGraFix method, amphipol exchange, optimization of grid preparation
NMRIsotope labeling (15N, 13C), high concentration, small sizeDomain-focused approach, selective labeling

Studies have demonstrated that the hydrophobicity of transmembrane regions significantly impacts expression efficiency, with mutations like W56R in yeast Cox2 increasing expression by reducing hydrophobicity and improving membrane insertion .

What approaches can detect interactions between MT-CO2 and other respiratory complex components?

Detecting protein-protein interactions involving MT-CO2 requires specialized techniques that preserve the native membrane environment or accurately replicate it. Researchers can employ the following methodological approaches:

  • Co-immunoprecipitation with crosslinking:

    • Chemical crosslinkers like DSP or DSG can stabilize transient interactions

    • Perform precipitation using antibodies against MT-CO2 or potential interacting partners

    • Analyze precipitated complexes by Western blotting or mass spectrometry

    • This approach has identified interactions between Cox2 and assembly factors in model organisms

  • Blue Native PAGE for respiratory complex identification:

    • Solubilize mitochondrial membranes in digitonin or other mild detergents

    • Separate native complexes on gradient gels

    • Perform in-gel activity assays to identify active complexes

    • Cut bands for second-dimension SDS-PAGE to resolve individual subunits

    • Research has shown this technique can effectively separate different forms of cytochrome c oxidase, including monomeric complex IV, the IV* subcomplex lacking Cox6, and the III₂IV₁ and III₂IV₂ supercomplexes

  • Proximity labeling techniques:

    • Express MT-CO2 fused to enzymes like BioID or APEX2

    • Allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins for identification by mass spectrometry

    • This approach provides spatial information about the protein's interaction network

  • Fluorescence-based interaction assays:

    • FRET (Förster Resonance Energy Transfer) between labeled components

    • Bimolecular Fluorescence Complementation (BiFC) for direct visualization

    • These approaches can detect interactions in living cells or reconstituted systems

Studies in yeast have demonstrated that cytochrome c oxidase forms stable supercomplexes with the bc₁ complex (Complex III), which can be detected and quantified using these techniques .

How can researchers address common challenges in MT-CO2 functional studies?

Functional studies with Nothoprocta perdicaria MT-CO2 present several technical challenges. Here are methodological solutions for addressing the most common issues:

  • Low activity in reconstituted systems:

    • Challenge: Recombinant MT-CO2 often shows reduced activity compared to native protein

    • Solution: Optimize lipid composition by incorporating cardiolipin (15-20% of total lipids), which is critical for cytochrome c oxidase function

    • Method: Test different lipid compositions using systematic activity assays

    • Analysis: Compare activity rates normalized to protein content across conditions

  • Aggregation during purification:

    • Challenge: Hydrophobic transmembrane domains promote aggregation

    • Solution: Implement a gradient purification approach with decreasing detergent concentrations

    • Method: Begin with higher detergent concentrations (2-3x CMC) during extraction, gradually reducing to 1-1.5x CMC during purification steps

    • Validation: Monitor aggregation state using dynamic light scattering before functional assays

  • Inconsistent copper incorporation:

    • Challenge: Recombinant expression may result in incomplete metallation

    • Solution: Reconstitute with copper in vitro using controlled Cu(I) donors

    • Method: Incubate purified protein with Cu(I)-tetrakis(acetonitrile)hexafluorophosphate in the presence of reducing agents

    • Verification: Measure copper content using atomic absorption spectroscopy

  • Distinguishing direct vs. indirect effects in mutation studies:

    • Challenge: Mutations may affect multiple aspects of protein function

    • Solution: Implement a systematic analysis pipeline

    • Method: Analyze each step separately: expression level, membrane insertion, complex assembly, and catalytic activity

    • Research evidence: Studies in yeast have successfully separated effects of mutations on import efficiency from effects on catalytic function, as demonstrated with the W56R mutation

This methodological framework provides researchers with strategies to overcome common technical obstacles while ensuring reliable and reproducible results.

What are the critical considerations for designing comparative studies between species using MT-CO2?

When designing comparative studies between Nothoprocta perdicaria MT-CO2 and orthologs from other species, researchers should address several critical methodological considerations:

  • Sequence and structural homology assessment:

    • Use multiple sequence alignment tools optimized for membrane proteins

    • Quantify conservation at functional sites (copper binding, proton channels)

    • Identify species-specific insertions/deletions that may affect function

    • Calculate evolutionary distances to inform experimental design

  • Experimental standardization:

    • Express all orthologous proteins using identical systems

    • Standardize purification protocols across all proteins being compared

    • Use consistent assay conditions, adjusting only the variables under investigation

    • Include appropriate positive and negative controls for each species

  • Consideration of physiological context:

    • Account for native temperature ranges of source organisms

    • Consider metabolic rates and oxygen consumption differences

    • Adjust pH to match physiological conditions of each species

    • Incorporate relevant lipid compositions reflecting native membranes

A methodological approach for comparing MT-CO2 across species:

ParameterMeasurement TechniqueNormalization MethodExpected Variation
Catalytic rateOxygen consumptionActivity per molecule2-5 fold between species
Thermal stabilityDifferential scanning calorimetryTm (melting temperature)Correlates with optimal body temperature
Supercomplex stabilityBlue Native PAGEComplex:monomer ratioHigher in species with greater metabolic demands
Proton pumping efficiencypH monitoring in proteoliposomesH+/e- ratioGenerally conserved with subtle variations

Research has demonstrated that even highly conserved proteins like cytochrome c oxidase subunits show adaptive variations that correlate with metabolic requirements and environmental factors specific to each species .

What emerging technologies might advance MT-CO2 research?

Several cutting-edge technologies are poised to revolutionize research on Nothoprocta perdicaria MT-CO2 and cytochrome c oxidase biology more broadly:

  • Cryo-electron microscopy advances:

    • Application: High-resolution structural determination of MT-CO2 in membrane environments

    • Methodological approach: Single-particle analysis coupled with tomography

    • Expected insights: Visualization of dynamic states and conformational changes during catalytic cycle

    • Advantage over current methods: Can capture multiple functional states without crystallization

  • Single-molecule functional assays:

    • Application: Real-time monitoring of individual MT-CO2 molecules

    • Methodology: Fluorescence-based approaches combined with electrical recording

    • Expected insights: Stochastic behavior and rare states invisible in bulk measurements

    • Research impact: Could reveal heterogeneity in proton pumping efficiency

  • CRISPR-based mitochondrial genome editing:

    • Application: Precise manipulation of MT-CO2 in its native genomic context

    • Methodology: Mitochondrially-targeted nucleases with template-directed repair

    • Potential outcomes: Creation of model systems with specific MT-CO2 variants

    • Research advantage: Study effects without nuclear gene expression complications

  • Computational approaches:

    • Application: Molecular dynamics simulations of MT-CO2 function

    • Methodology: All-atom simulations in lipid bilayers across microsecond timescales

    • Expected insights: Proton and electron transfer pathways, conformational changes

    • Integration with experiments: Validation of computational predictions through targeted mutagenesis

These technologies will enable researchers to address fundamental questions about MT-CO2 function that remain challenging with current methodologies, particularly regarding the coupling between electron transfer and proton pumping mechanisms.

How might studies of MT-CO2 contribute to understanding mitochondrial diseases?

Research on Nothoprocta perdicaria MT-CO2 has significant potential to inform our understanding of mitochondrial diseases through comparative biology approaches:

  • Identifying functional conservation and divergence:

    • Methodological approach: Compare sequences and functions across species

    • Analysis: Identify residues that are invariant across all species versus those that diverge

    • Application: Predict pathogenicity of human MT-CO2 variants by comparing to avian counterparts

    • Research evidence: Studies in yeast have shown that mutations affecting assembly of cytochrome c oxidase have similar effects across species

  • Development of functional assays for variant assessment:

    • Experimental design: Create chimeric proteins combining regions from human and avian MT-CO2

    • Methodology: Assess function through oxygen consumption and electron transfer measurements

    • Application: Rapid screening platform for evaluating variants of unknown significance

    • Data interpretation: Establish functional thresholds for pathogenicity

  • Evolutionary medicine insights:

    • Research question: Why are some regions of MT-CO2 more tolerant to variation?

    • Approach: Compare variation patterns in healthy populations across species

    • Analysis: Correlate with functional domains and interaction surfaces

    • Expected outcome: Identification of mutational "hot spots" versus tolerant regions

  • Therapeutic strategy development:

    • Concept: Allotopic expression (nuclear expression of mitochondrial genes)

    • Experimental basis: Success with modified Cox2 in yeast models

    • Translational potential: Design of optimized human MT-CO2 variants for allotopic expression

    • Methodological considerations: Modification of hydrophobicity for improved import, as demonstrated with the W56R mutation in yeast Cox2

This research direction bridges fundamental comparative biology with translational medical applications, potentially offering new diagnostic and therapeutic approaches for mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.