Recombinant Notiomys edwardsii NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Respiration

MT-ND3 plays a crucial role in cellular respiration and energy production as part of the mitochondrial respiratory Complex I. This complex is the largest of the five respiratory complexes and serves as the primary entry point for electrons into the electron transport chain.

Contribution to Complex I Structure and Function

Within Complex I, MT-ND3 contributes significantly to the formation of the ubiquinone-binding site, which is critical for electron transport . The protein contains a long TMH1-2 loop that is partially disordered in certain conformational states of Complex I, suggesting its importance in the dynamic changes that occur during catalysis .

Research has demonstrated that MT-ND3 interacts extensively with the hydrophilic domain of Complex I, potentially serving as a conformational coupling element between the membrane domain and the hydrophilic domain . This interface is believed to be critical for converting the energy from electron transfer to proton pumping across the inner mitochondrial membrane.

One of the most notable features of MT-ND3 is its involvement in a chain of charged residues along the membrane domain of Complex I. Specifically, the residue ND3-Asp66 connects with ND1-Glu143 and the dynamic distortion in ND6-TMH3, forming part of a proton translocation pathway . This arrangement suggests that MT-ND3 plays a direct role in the proton pumping mechanism of Complex I.

Production and Characteristics of Recombinant MT-ND3

The recombinant form of Notiomys edwardsii MT-ND3 is produced using advanced protein expression systems to enable detailed structural and functional studies.

Applications in Research

Recombinant Notiomys edwardsii MT-ND3 has several important applications in biochemical and biomedical research.

Antibody Development and Immunological Studies

Recombinant MT-ND3 serves as an important immunogen for the development of antibodies used in various research applications. Antibodies against MT-ND3 are valuable tools for:

  1. Western blotting experiments to detect and quantify MT-ND3 in biological samples

  2. Immunoprecipitation studies to investigate protein-protein interactions involving MT-ND3

  3. Immunohistochemistry to visualize the distribution of MT-ND3 in tissue samples

These antibodies typically show high specificity for human MT-ND3, with the possibility of cross-reactivity with MT-ND3 from other mammalian species due to the high conservation of mitochondrial proteins .

Enzyme-Linked Immunosorbent Assay (ELISA)

Recombinant MT-ND3 is also utilized in the development of ELISA kits for the detection and quantification of MT-ND3 in biological samples . These assays provide a sensitive method for investigating changes in MT-ND3 levels under various physiological and pathological conditions.

Clinical Significance

The clinical significance of MT-ND3 stems from its critical role in mitochondrial function and energy production.

Pathogenic Variants and Associated Disorders

Pathogenic variants in the MT-ND3 gene are known to cause mitochondrial complex I deficiency (MT-C1D), which can manifest as a wide range of clinical disorders . The relationship between MT-ND3 mutations and disease states highlights the fundamental importance of this protein in cellular energy metabolism.

DiseaseCharacteristicsAssociation with MT-ND3
Leigh SyndromeProgressive neurological disorder with symmetrical lesions in the basal ganglia, thalamus, and brainstemCaused by mutations in MT-ND3 that impair Complex I function
Leber Hereditary Optic NeuropathyDegeneration of retinal ganglion cells and their axons leading to vision lossAssociated with specific mutations in MT-ND3
Mitochondrial EncephalopathyNeurological disorder affecting brain functionCan result from pathogenic variants in MT-ND3

Understanding the structure and function of MT-ND3 through studies with recombinant protein has contributed significantly to our knowledge of how mutations in this protein lead to disease states. This knowledge is essential for developing potential therapeutic strategies for mitochondrial disorders.

Comparative Analysis of MT-ND3 Across Species

The MT-ND3 protein is highly conserved across mammalian species, reflecting its essential role in cellular respiration. Comparative studies between Notiomys edwardsii MT-ND3 and MT-ND3 from other species provide valuable insights into the evolutionary conservation of this critical protein.

Studies of the mammalian respiratory Complex I have shown that the core subunits, including MT-ND3, closely match their bacterial counterparts, with preserved mechanistically-relevant features . This conservation underscores the fundamental importance of these proteins in cellular energy production across diverse organisms.

Future Research Directions

The availability of recombinant Notiomys edwardsii MT-ND3 opens several avenues for future research:

  1. Detailed structural studies to further elucidate the mechanism of proton pumping in Complex I

  2. Investigation of potential small-molecule modulators of MT-ND3 function for therapeutic applications

  3. Development of more sensitive diagnostic tools for mitochondrial disorders associated with MT-ND3 dysfunction

  4. Comparative studies with MT-ND3 from other species to understand evolutionary adaptations in mitochondrial function

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipment, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Notiomys edwardsii (Edwards's long-clawed mouse)
Target Names
Target Protein Sequence
MNMLITMTVNSALSFCLISIAFWLPHLNIYTEKASPYECGFDPMSSARLPFSLKFFLVGI TFLLFDLEIALLLPLPWAMHSPNTTTTMMVSFMFVSILALGLAYEWLNKGLEWTE
Uniprot No.

Target Background

Function
This protein constitutes the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. This function is crucial for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of MT-ND3 in mitochondrial function?

MT-ND3 functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which catalyzes electron transfer from NADH through the respiratory chain using ubiquinone as an electron acceptor. This protein is essential for the catalytic activity of Complex I and assists in proton translocation across the mitochondrial membrane—a process indispensable for generating the electrochemical gradient used in ATP synthesis . In Notiomys edwardsii, as in other mammals, the conserved ND3 loop is involved in active/deactive state transitions of Complex I, regulating respiratory chain function under varying physiological conditions .

How does the structure of MT-ND3 relate to its function?

MT-ND3 contains conserved domains that facilitate its role in the respiratory chain. The protein features a critical loop region involved in active/deactive state transitions of Complex I . Structural studies have shown that specific residues in this loop undergo conformational changes during the catalytic cycle, particularly during the transition between active and deactive states. When working with recombinant MT-ND3, researchers should consider that proper folding of this loop region is essential for functional studies, as alterations can significantly affect enzyme kinetics and proton pumping efficiency.

What are the key differences between MT-ND3 from Notiomys edwardsii and other rodent species?

While specific data on Notiomys edwardsii MT-ND3 is limited, comparative genomic analyses of MT-ND3 across rodent species show conservation of key functional domains with species-specific variations in non-catalytic regions. These variations may reflect evolutionary adaptations to different metabolic demands or environmental conditions. When designing experiments with recombinant Notiomys edwardsii MT-ND3, researchers should consider sequence homology with better-characterized systems such as mouse MT-ND3, which shares significant sequence identity but may differ in specific amino acid residues that could affect antibody recognition or protein-protein interactions .

What expression systems are most effective for producing recombinant MT-ND3?

  • Use codon-optimized constructs for the expression host

  • Include a cleavable tag (His6 or GST) for purification

  • Consider fusion partners that enhance solubility

  • Employ membrane-mimetic environments during purification

For functional studies, co-expression with other Complex I subunits may be necessary to obtain properly folded protein with native-like activity.

What are the most reliable methods for verifying the structural integrity of purified recombinant MT-ND3?

Verification of structural integrity for recombinant MT-ND3 requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Limited proteolysis to evaluate folding quality

  • Size exclusion chromatography to confirm oligomeric state

  • Activity assays measuring NADH:ubiquinone oxidoreductase function

When working with Notiomys edwardsii MT-ND3, researchers have found that thermal stability assays using differential scanning fluorimetry can provide valuable information about protein folding quality. Properly folded MT-ND3 typically shows characteristic thermal denaturation profiles that can be used as quality control benchmarks for different preparation batches.

How can I optimize antibody-based detection of recombinant MT-ND3?

For optimal antibody-based detection of recombinant Notiomys edwardsii MT-ND3:

  • Use antibodies raised against conserved epitopes of MT-ND3

  • Consider that commercial antibodies against human MT-ND3 may cross-react with Notiomys edwardsii MT-ND3 due to sequence conservation

  • Optimize blocking conditions to reduce background (5% BSA often performs better than milk-based blockers)

  • For immunohistochemistry applications, use antigen retrieval methods optimized for mitochondrial proteins

Commercial antibodies like those targeting human MT-ND3 have been successfully used in rodent samples with protocols incorporating overnight primary antibody incubation at 4°C and detection using HRP-conjugated secondary antibodies .

How can recombinant MT-ND3 be used to study mitochondrial dysfunction in disease models?

Recombinant MT-ND3 serves as a valuable tool for studying mitochondrial dysfunction in various disease models through several methodological approaches:

  • Reconstitution experiments: Purified recombinant MT-ND3 can be incorporated into liposomes or nanodiscs to study its specific contribution to proton translocation and electron transfer.

  • Protein-protein interaction studies: Using recombinant MT-ND3 as bait in pull-down assays or yeast two-hybrid screens to identify interaction partners that may be dysregulated in disease states.

  • Structural studies: Recombinant protein can be used for crystallography or cryo-EM studies to elucidate how disease-associated mutations affect protein structure.

  • Functional complementation: Introducing recombinant MT-ND3 into cellular models with MT-ND3 deficiency to assess rescue of function.

Research has demonstrated that MT-ND3 polymorphisms are associated with multiple conditions including gastric cancer, Parkinson's disease, type 2 diabetes mellitus, and other cancers , making functional studies particularly relevant for understanding disease mechanisms.

What approaches can be used to study the effect of MT-ND3 mutations on Complex I activity?

To study the effects of MT-ND3 mutations on Complex I activity:

  • Site-directed mutagenesis: Generate recombinant MT-ND3 variants containing specific mutations identified in disease states.

  • Enzymatic activity assays: Measure NADH:ubiquinone oxidoreductase activity using spectrophotometric methods (monitoring NADH oxidation at 340 nm) for wild-type and mutant proteins.

  • Respirometry: Assess oxygen consumption rates in reconstituted systems or cells expressing mutant forms.

  • ROS production assays: Quantify reactive oxygen species generation using fluorescent probes to determine if mutations increase oxidative stress.

Studies have shown that certain polymorphisms in MT-ND3, such as rs2853826, are associated with increased ROS production in type 2 diabetes mellitus . Similar approaches can be applied to study mutations in Notiomys edwardsii MT-ND3 and their potential pathophysiological consequences.

How can MT-ND3 genetic variants be effectively analyzed in population studies?

For population-level analysis of MT-ND3 genetic variants:

  • PCR amplification and Sanger sequencing: Design primers specific to MT-ND3 gene regions. For Notiomys edwardsii MT-ND3, primers can be designed based on conserved regions flanking the gene.

  • Next-generation sequencing: For high-throughput analysis of multiple samples.

  • RFLP analysis: For rapid screening of known polymorphisms.

  • Statistical analysis: Case-control studies using appropriate statistical methods to assess associations between variants and phenotypes.

One approach used successfully in human studies employed PCR primers (forward: 5′-CCACAACTCAACGGCTACAT-3′, reverse: 5′-TGGGTGTTGAGGGTTATGAG-3′) to generate a 491 bp product, which was then sequenced to identify SNPs . Similar methodology can be adapted for Notiomys edwardsii with species-specific primer design.

What are the current methods for mitochondrial gene editing targeting MT-ND3?

Recent advances in mitochondrial gene editing have created new possibilities for MT-ND3 modification:

  • DddA-derived cytosine base editors (DdCBEs): These have been successfully used to edit mammalian MT-ND3 in vivo via adeno-associated viral delivery systems. This technique allows for precise C-to-T conversions in specific regions of MT-ND3 .

  • TALE-based approaches: Transcription activator-like effector (TALE) domains can be designed to bind specific mtDNA sequences flanking the MT-ND3 gene to direct editing machinery.

  • Mitochondrially-targeted zinc finger nucleases: Although challenging due to mitochondrial import limitations, these systems have shown promise for targeted editing.

For Notiomys edwardsii MT-ND3, researchers would need to design species-specific TALE domains targeting the mtDNA light and heavy strands surrounding the MT-ND3 gene, similar to approaches used in mouse models where TALE domains targeting mtDNA positions m.9549–m.9564 and m.9584–m.9599 were employed .

How can recombinant MT-ND3 be used to validate mitochondrial editing outcomes?

Validation of mitochondrial editing outcomes using recombinant MT-ND3 involves several complementary approaches:

  • Functional reconstitution: Comparing the activity of recombinant wild-type and edited MT-ND3 proteins in in vitro systems.

  • Structural analysis: Using purified recombinant proteins to assess structural changes resulting from genetic modifications.

  • Antibody validation: Developing and validating antibodies against edited epitopes using recombinant proteins as standards.

  • Mass spectrometry: Using recombinant proteins as references for peptide identification in proteomics analyses of edited cells.

In studies involving mouse MT-ND3, researchers have used next-generation sequencing to detect edited cytosines, with editing efficiencies of 20-30% achieved in cardiac tissue following AAV delivery of base editors . Similar validation approaches would be applicable for Notiomys edwardsii MT-ND3 editing experiments.

What are the technical challenges in achieving homoplasmic MT-ND3 modifications?

Achieving homoplasmic (affecting all copies of mtDNA) modifications of MT-ND3 presents several technical challenges:

  • Multiple mtDNA copies: Mammalian cells contain hundreds to thousands of mtDNA copies, making complete modification difficult.

  • Mitochondrial selection pressures: Modified mtDNA may have replicative advantages or disadvantages, affecting heteroplasmy levels over time.

  • Tissue-specific considerations: Different tissues show varying thresholds for manifesting phenotypes based on heteroplasmy levels.

  • Delivery efficiency: Ensuring editing machinery reaches all mitochondria in target cells.

These challenges can be addressed through:

  • Multiple rounds of editing

  • Selection strategies to enrich for modified mitochondria

  • Long-term monitoring of heteroplasmy levels post-editing

  • Use of mitochondrially-targeted restriction endonucleases to selectively eliminate unmodified mtDNA

How does MT-ND3 sequence conservation compare across rodent species?

MT-ND3 shows significant sequence conservation across rodent species, reflecting its essential role in mitochondrial function. Key observations include:

  • Functional domains: Regions involved in proton translocation and Complex I assembly show highest conservation.

  • Species-specific variations: Non-catalytic regions may show more variation, potentially reflecting adaptations to different metabolic demands.

  • Evolutionary rate: MT-ND3 evolves at a moderate rate compared to other mitochondrial genes, with synonymous substitutions more common than non-synonymous ones.

While specific comparative data for Notiomys edwardsii MT-ND3 is limited, research on related rodent species suggests that this protein maintains high functional conservation while accommodating species-specific adaptations in non-critical regions .

What functional adaptations of MT-ND3 have been observed in species with different metabolic demands?

MT-ND3 shows evidence of adaptation to different metabolic demands across species:

  • High-metabolism species: Often show amino acid substitutions that may enhance electron transfer efficiency or alter the regulation of active/deactive transitions.

  • Hypoxia-adapted species: May contain variations that modify ROS production during oxygen limitation.

  • Thermoregulation adaptations: Species from extreme environments may have MT-ND3 variants that affect coupling efficiency, potentially allowing for adaptive heat generation.

For Notiomys edwardsii, a rodent adapted to specific environmental conditions, studies of recombinant MT-ND3 could reveal functional adaptations related to its ecological niche, particularly in comparison to laboratory rodent models.

How can recombinant MT-ND3 from different species be used in comparative structure-function studies?

Comparative structure-function studies using recombinant MT-ND3 from different species offer valuable insights:

  • Chimeric proteins: Creating chimeric proteins where domains from different species are swapped to identify regions responsible for functional differences.

  • Parallel mutagenesis: Introducing identical mutations in MT-ND3 from different species to assess contextual effects of the surrounding sequence.

  • Heterologous reconstitution: Assembling Complex I with components from different species to assess compatibility and functional conservation.

  • Evolutionary biochemistry: Correlating biochemical properties with phylogenetic relationships to understand the evolutionary trajectory of MT-ND3 function.

These approaches could reveal how subtle sequence differences in Notiomys edwardsii MT-ND3 contribute to species-specific adaptations in mitochondrial function, potentially informing both basic evolutionary biology and biomedical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.