Recombinant Novosphingobium aromaticivorans Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Saro_0880; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)
Target Names
mscL
Target Protein Sequence
MAHEVKGEILGMLGEFKKFIARGNVLDLAVGVIIGGAFGKIVTSLTESVIMPVVGWLTGG VDFTRYFVRLGPVPADFKGDPTSYAELKAAGVPMIGYGDFITQAVNFVIVAFIIFLIVKA VNRMFEKPEEAPAAPSGPTEVELLAEIRDALKAKG
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Novosphingobium aromaticivorans and what are its key characteristics?

Novosphingobium aromaticivorans is a mesophilic, Gram-negative, rod-shaped bacterium belonging to the family Sphingomonadaceae. This bacterium contains characteristic sphingoglycolipids in its cell membrane. Morphological and biochemical characterization shows that N. aromaticivorans colonies display yellow coloration with rounded raised edges and smooth surfaces. Under microscopic examination, the cells appear rod-shaped without spore production .

The bacterium shows significant metabolic versatility, particularly in degrading aromatic compounds. According to comparative genomic analyses, Novosphingobium strains have been isolated from diverse habitats including rhizosphere soil, plant surfaces, heavily contaminated soils, and both marine and freshwater environments . For example, N. aromaticivorans F199 (type strain DSM 12444) was isolated from subsurface Cretaceous age formation at 410 m depth, while strain B0712 was isolated from a subsurface core at 359 m depth .

Growth studies indicate that Novosphingobium species grow optimally at 37°C in LB medium supplemented with 0.1% glucose at pH 7.0. The bacteria can grow under a range of conditions including pH 5.0-8.0 and temperatures between 25-37°C .

What are the standard protocols for expressing and purifying recombinant N. aromaticivorans mscL protein?

Based on commercial production protocols, recombinant N. aromaticivorans mscL is typically expressed in E. coli expression systems with an N-terminal histidine tag. A comprehensive protocol includes:

Expression System:

  • Gene source: Saro_0880 (synonyms: mscL, Large-conductance mechanosensitive channel)

  • Expression host: E. coli

  • Vector design: Includes N-terminal His-tag for purification

  • Protein length: Full length (1-155 amino acids)

Expression Protocol:

  • Transform expression plasmid into competent E. coli cells

  • Culture cells in appropriate media with selection antibiotics

  • Induce protein expression (typically with IPTG for T7-based systems)

  • Harvest cells by centrifugation after optimal expression period

Purification Strategy:

  • Lyse cells using mechanical or chemical methods

  • Clarify lysate by centrifugation to remove cellular debris

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Wash column with low concentrations of imidazole to remove non-specifically bound proteins

  • Elute His-tagged mscL with buffer containing high imidazole concentration

  • Perform buffer exchange to remove imidazole

Quality Control:

  • Verify purity by SDS-PAGE (should exceed 90%)

  • Confirm identity by mass spectrometry or western blot

  • Validate protein folding by circular dichroism or functional assays

Storage Conditions:

  • Formulate in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Lyophilize for long-term stability

  • Store at -20°C/-80°C, with aliquoting recommended to avoid freeze-thaw cycles

  • For working solutions, reconstitute to 0.1-1.0 mg/mL and add 5-50% glycerol for storage at -20°C

How can researchers optimize culture conditions for studying Novosphingobium sp. physiology and mscL function?

Optimizing culture conditions is critical for studying Novosphingobium physiology and mscL function. Research on Novosphingobium sp. reveals the following optimal parameters:

Table 1: Optimal Growth Conditions for Novosphingobium sp.

ParameterOptimal ConditionViable RangeNotes
Media0.1% glucose LBLB, 0.1% glucose LB, NB, 0.1% glucose NB, MMHighest growth observed in glucose-supplemented LB
Temperature37°C25-55°CSignificant growth decrease observed above 45°C
pH7.04.0-10.0Growth significantly reduced below pH 5 and above pH 8
Loading volume60mL/150mL20-100mL/150mLBalance between oxygen availability and culture density

When designing experiments to study mscL function specifically, researchers should consider:

  • Carbon source effects: The addition of 0.1% glucose to standard media significantly enhances growth of Novosphingobium sp., providing a more robust system for protein expression .

  • Osmotic challenge experiments: For studying mscL function, researchers should establish baseline growth in optimal conditions followed by controlled osmotic challenges to observe channel activation.

  • Temperature variation: While 37°C is optimal for growth, temperature affects membrane fluidity, which directly impacts mscL gating properties. Experiments at varying temperatures (25-37°C) may reveal temperature-dependent aspects of channel function.

  • pH considerations: Maintaining pH at 7.0 provides optimal growth conditions, but studying mscL function across the viable pH range (5.0-8.0) may reveal pH-dependent aspects of channel behavior .

  • Growth phase monitoring: Studies have shown that gene expression in Novosphingobium can vary significantly with growth phase, suggesting that mscL function may also be growth phase-dependent .

How does the structure and function of N. aromaticivorans mscL compare to mscL proteins from other bacterial species?

Comparative analysis of mscL proteins from different bacterial species reveals both conserved features and species-specific adaptations. Below is a comparison of amino acid sequences from several bacterial species:

Table 2: Comparative Analysis of mscL Proteins from Different Bacterial Species

SpeciesProtein LengthKey Structural FeaturesUniProt ID
Novosphingobium aromaticivorans155 aaExtended N-terminal regionQ2G9Z8
Escherichia coli137 aaShorter sequence with conserved coreA1AGI2
Roseobacter denitrificans142 aaIntermediate length with unique C-terminusQ16BG3
Psychrobacter sp.143 aaDistinct transmembrane organizationA5WCE5

The mscL sequence from N. aromaticivorans (155 aa) is notably longer than that of E. coli (137 aa), suggesting potential additional regulatory domains or structural features. Despite sequence variations, all mscL proteins share conserved transmembrane regions that form the channel pore and are responsible for mechanosensation .

Sequence alignment shows conservation in the core transmembrane domains while diversity appears greater in the N-terminal and C-terminal regions. These variations likely reflect adaptations to different membrane compositions and environmental pressures experienced by each species. For Novosphingobium, which contains characteristic sphingoglycolipids in its membrane, these adaptations may be particularly important for proper channel function in its unique membrane environment .

The functional implications of these structural differences remain to be fully characterized, but they suggest potential variations in tension sensitivity thresholds, gating kinetics, and regulatory mechanisms across bacterial species.

What role might mscL play in the environmental adaptation of Novosphingobium species to diverse habitats?

Genomic analyses have demonstrated that Novosphingobium strains possess habitat-specific genes that facilitate adaptation to diverse ecological niches . While the specific contribution of mscL to this adaptation hasn't been directly characterized, several lines of evidence suggest important roles:

  • Habitat-specific membrane adaptations: Comparative genomic analysis reveals that "phylogenetic relationships were mostly influenced by metabolic trait enrichment, which is possibly governed by the microenvironment of each microbe's respective niche" . Since mscL function depends on membrane properties, variations in the channel may represent adaptations to habitat-specific membrane compositions.

  • Osmotic stress response: Novosphingobium species inhabit environments ranging from freshwater to contaminated soils with varying osmotic conditions . The mscL channel would be critical for surviving osmotic fluctuations characteristic of these diverse habitats.

  • Integration with stress response systems: Research on Novosphingobium sp. HR1a identified that the regulatory protein LuxR402 controls cellular aggregation in response to environmental stressors . MscL likely functions as part of this integrated stress response network, potentially with habitat-specific variations.

  • Subsurface adaptation: N. aromaticivorans strains have been isolated from deep subsurface environments (359-410m depths) , suggesting adaptation to high-pressure conditions. MscL, as a mechanosensitive channel, would be directly affected by pressure and may have evolved specific properties to function in these environments.

  • Environmental toxin response: Novosphingobium species are known for their ability to degrade aromatic compounds and environmental toxins . MscL may contribute to survival during exposure to these compounds by helping maintain membrane integrity during detoxification processes.

These adaptations likely manifest as variations in mscL structure, expression patterns, or regulatory mechanisms across Novosphingobium strains from different habitats. Further research directly comparing mscL properties across strains would help elucidate its specific contributions to habitat adaptation.

How can functional studies of recombinant mscL contribute to understanding bacterial responses to antibiotic and environmental stressors?

Functional studies of recombinant mscL can provide valuable insights into bacterial stress responses through several research approaches:

  • Liposome reconstitution studies: Purified recombinant mscL can be reconstituted into liposomes with defined lipid compositions to study:

    • Channel gating in response to membrane tension

    • Effects of antimicrobial compounds on channel function

    • Interactions between membrane composition and channel properties

  • Antibiotic resistance investigations: Recent research indicates that environmentally relevant antibiotic concentrations exert stronger effects on bacterial communities including Novosphingobium . MscL functional studies can examine:

    • Whether antibiotics alter membrane properties that affect mscL gating

    • If mscL contributes to antibiotic tolerance by responding to membrane stress

    • Potential correlations between mscL variations and antibiotic susceptibility patterns

  • Environmental stress modeling: Using recombinant mscL in controlled systems allows researchers to mimic environmental stressors:

    • Effects of pH, temperature, and osmolarity fluctuations on channel function

    • Responses to organic pollutants that Novosphingobium species naturally degrade

    • Carbon source limitations that affect membrane composition and channel activity

  • Comparative genomic-functional analyses: Combining sequence data with functional studies of recombinant mscL variants can reveal:

    • Structure-function relationships across bacterial species

    • Habitat-specific adaptations in channel properties

    • Evolutionary patterns in mechanosensitive channel diversification

  • Integration with transcriptomic data: Recent transcriptomic data sets for N. aromaticivorans under various growth conditions could be correlated with mscL functional studies to understand:

    • Expression patterns under different stressors

    • Co-expression networks involving mscL

    • Regulatory mechanisms controlling channel production and function

Such studies would provide mechanistic insights into how bacteria sense and respond to environmental challenges, potentially revealing new targets for antimicrobial development or strategies for environmental bioremediation.

What are the main technical challenges in working with recombinant mechanosensitive channels and how can they be addressed?

Working with recombinant mechanosensitive channels presents several technical challenges that require specialized approaches:

  • Membrane protein expression challenges

    • Challenge: Low expression yields and protein misfolding

    • Solutions:

      • Use specialized E. coli strains designed for membrane protein expression

      • Express at lower temperatures (18-25°C) to improve folding

      • Optimize codon usage for the expression host

      • Consider fusion partners that enhance solubility (MBP, SUMO)

  • Protein solubilization and purification difficulties

    • Challenge: Extracting functional protein from membranes without denaturation

    • Solutions:

      • Screen multiple detergents for optimal extraction efficiency

      • Use native nanodiscs or styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

      • Employ gentle purification conditions to maintain native structure

      • Include stabilizing agents during purification (glycerol, specific lipids)

  • Functional characterization complexities

    • Challenge: Assessing channel function in artificial systems

    • Solutions:

      • Reconstitute purified channels in liposomes for patch-clamp electrophysiology

      • Develop fluorescence-based assays to monitor channel opening

      • Use stopped-flow spectroscopy to measure solute flux through channels

      • Engineer reporter systems that couple channel activity to measurable outputs

  • Structural stability issues

    • Challenge: Maintaining protein stability during storage and experimentation

    • Solutions:

      • Store as lyophilized powder with trehalose (6%) as used for commercial preparations

      • Add glycerol (5-50%) for frozen storage solutions

      • Avoid repeated freeze-thaw cycles

      • Consider amphipols or nanodiscs for long-term stability

  • Biochemical assay limitations

    • Challenge: Developing assays that accurately assess mechanosensitive properties

    • Solutions:

      • Use micropipette aspiration of giant unilamellar vesicles containing reconstituted channels

      • Employ microfluidic devices to apply controlled membrane tension

      • Develop high-throughput screening approaches for channel modulators

      • Use molecular dynamics simulations to predict channel behavior under conditions difficult to test experimentally

These technical solutions have enabled successful work with mechanosensitive channels from various bacterial species, including the recombinant N. aromaticivorans mscL protein that is now commercially available with greater than 90% purity .

How can researchers address the challenges of studying mscL in its native membrane environment versus reconstituted systems?

The study of mscL presents a fundamental challenge: balancing investigations in the native bacterial membrane environment against the experimental control offered by reconstituted systems. Each approach has distinct advantages and limitations:

Native Membrane Studies:

AdvantagesLimitationsMethodological Solutions
Authentic lipid compositionComplex system with multiple variablesUse genetic approaches to modify native mscL expression
Natural protein interactions preservedDifficult to isolate mscL-specific effectsEmploy specific channel blockers or modulators
Physiologically relevant functionLimited experimental manipulationUse patch-clamp electrophysiology on bacterial spheroplasts
Includes native regulatory mechanismsChallenging to control membrane tensionApply osmotic shocks of defined magnitude

Reconstituted System Studies:

AdvantagesLimitationsMethodological Solutions
Defined composition and conditionsMay not recapitulate native functionSystematically vary lipid composition to mimic native membrane
Isolated mscL functionLoss of protein-protein interactionsCo-reconstitute with potential interacting partners
Precise control of membrane tensionArtificial membrane propertiesUse native lipid extracts from Novosphingobium
Amenable to structural studiesSample preparation artifactsValidate findings with complementary techniques

Bridging Approaches:

  • Spheroplast-derived membrane vesicles: Prepare vesicles from Novosphingobium membranes containing native or modified mscL, preserving natural lipid environment while allowing controlled experimental manipulation.

  • Native nanodiscs: Extract mscL with surrounding native lipids using styrene maleic acid copolymers, maintaining the local membrane environment while enabling detailed biophysical studies.

  • Genetic complementation studies: Express recombinant mscL variants in mscL-deficient bacteria and assess function under physiological stress conditions to validate findings from reconstituted systems.

  • Crosslinking approaches: Identify native protein interactions with mscL through in vivo crosslinking followed by mass spectrometry, then recreate these interactions in reconstituted systems.

  • Correlative microscopy: Combine fluorescence microscopy of labeled mscL in live cells with electrophysiological measurements to connect channel activity to cellular localization and membrane properties.

These complementary approaches provide a more complete understanding of mscL function than either native or reconstituted studies alone, especially important for Novosphingobium species with their unique sphingoglycolipid-containing membranes .

What are the emerging applications of mscL research in biotechnology and environmental science?

Research on mechanosensitive channels, particularly from metabolically versatile organisms like Novosphingobium aromaticivorans, offers promising applications across multiple fields:

  • Bioremediation enhancement:

    • Engineer mscL variants to improve survival of Novosphingobium strains in contaminated environments

    • Optimize stress tolerance for bioremediation applications leveraging Novosphingobium's ability to degrade aromatic compounds

    • Develop biosensor systems using mscL to detect environmental toxins

  • Biosensor development:

    • Create tension-sensing systems using modified mscL channels coupled to reporter molecules

    • Develop bacterial whole-cell biosensors for environmental monitoring

    • Engineer membrane-stress detection systems for high-throughput screening applications

  • Controlled cellular release systems:

    • Utilize engineered mscL channels for controlled release of cellular contents

    • Develop pressure-triggered release of bioproducts in industrial fermentation

    • Create stress-responsive bacterial delivery systems for environmental applications

  • Antibiotic development:

    • Target bacterial mechanosensitive channels as novel antibiotic targets

    • Understand how channel function relates to antibiotic resistance mechanisms observed in Novosphingobium species

    • Develop compounds that dysregulate osmotic stress responses

  • Membrane engineering:

    • Transfer Novosphingobium mscL to other organisms to confer stress resistance

    • Engineer synthetic cells with programmable osmotic response properties

    • Create artificial membrane systems with controlled permeability

  • Environmental adaptation research:

    • Study how mscL variants contribute to bacterial adaptation to extreme environments

    • Understand bacterial community responses to environmental stressors

    • Develop models for predicting bacterial responses to changing environmental conditions

These applications build on recent findings that Novosphingobium possesses habitat-specific genes and can degrade environmental contaminants , suggesting that its mscL may have unique properties optimized for surviving in challenging environments while performing biodegradation functions.

How might systems biology approaches enhance our understanding of mscL function within the broader context of bacterial stress responses?

Systems biology approaches offer powerful frameworks for understanding mscL function as part of integrated bacterial stress response networks:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models of stress responses

    • Recent transcriptomic datasets for N. aromaticivorans under various growth conditions provide foundations for such analyses

    • Correlate mscL expression patterns with global cellular responses to identify co-regulated processes

  • Network analysis of stress response pathways:

    • Map interactions between osmotic, oxidative, and other stress response systems

    • Identify regulatory hubs that coordinate multiple stress responses

    • Position mscL within these networks to understand its broader physiological context

    • Build on findings of "habitat-specific protein hubs" identified in Novosphingobium species

  • Comparative genomics with functional validation:

    • Analyze mscL sequence variations across Novosphingobium strains from different habitats

    • Correlate sequence differences with functional properties

    • Validate computational predictions through targeted mutagenesis and functional assays

    • Extend understanding of how "habitat-specific genes" contribute to environmental adaptation

  • Single-cell analyses:

    • Examine cell-to-cell variation in mscL expression and activity

    • Study how heterogeneity in mscL function affects population-level stress resistance

    • Link single-cell behaviors to community-level phenomena like the flocculation observed in Novosphingobium sp. HR1a

  • Mathematical modeling of integrated stress responses:

    • Develop predictive models of how multiple stressors affect mscL function

    • Simulate membrane tension dynamics under various environmental conditions

    • Model how mscL activity interfaces with carbon metabolism and other cellular processes

    • Build on findings of how carbon source availability affects Novosphingobium growth and stress responses

  • Community-level ecological approaches:

    • Study how mscL function affects bacterial community dynamics

    • Investigate role of Novosphingobium in mixed-species biofilms under stress conditions

    • Extend research on how "bacterial adaptation is constrained in complex communities" to include mechanosensitive channel functions

These systems biology approaches would provide a more complete understanding of how mechanosensitive channels contribute to bacterial survival in complex, changing environments, particularly for metabolically versatile organisms like Novosphingobium aromaticivorans that inhabit diverse ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.