Recombinant Novosphingobium aromaticivorans Protoheme IX farnesyltransferase (ctaB)

Shipped with Ice Packs
In Stock

Description

Production and Expression System

The recombinant protein is synthesized using an E. coli in vitro expression system .

ParameterDetails
Expression SystemE. coli
TagN-terminal 10xHis
PurityFull-length protein
Storage-20°C (short-term); -80°C (long-term); avoid repeated freeze-thaw cycles
Immunogen SpeciesNovosphingobium aromaticivorans DSM 12444

Functional Role and Biological Significance

CtaB catalyzes the conversion of protoheme IX to heme O via farnesylation, a critical step in heme A synthesis required for cytochrome c oxidase assembly. In N. aromaticivorans, this enzyme supports respiratory chain functionality, which indirectly influences metabolic pathways for aromatic compound degradation .

Key Functional Insights:

  • Conserved Activity: Structural homology with Staphylococcus aureus CtaB suggests a conserved role in heme biosynthesis across bacteria .

  • Biotechnological Relevance: Heme-dependent oxidases are essential for cellular energy metabolism, linking CtaB to broader applications in microbial engineering .

Comparative Genomic Insights

While N. aromaticivorans CtaB shares functional parallels with homologs in other bacteria (e.g., S. aureus), its genomic context differs:

  • Gene Localization: Located on the chromosome, distinct from plasmid-borne metabolic genes in N. aromaticivorans .

  • Regulatory Links: Transcriptional coordination with aromatic degradation pathways remains uncharacterized but plausible given the organism’s metabolic versatility .

Research Applications and Biotechnological Potential

Recombinant CtaB serves as a tool for:

  • Heme Biosynthesis Studies: Elucidating mechanisms of respiratory chain assembly in sphingomonads.

  • Engineered Strains: Optimizing N. aromaticivorans for bioremediation or bioproduction by modulating heme-dependent enzymes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ctaB; Saro_0915; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)
Target Names
ctaB
Target Protein Sequence
MDSAKPLALPADWRDFFALTKPRVMTLVIFTGLCGLLAAPGTIHPVIAFTAILCIAVGAG GAAALNQWWEADIDAGMKRTAQRPLPAGRMDRTSARDFGFALAGGSVFVMGLGVGWLAAV ILAFSIFYYSWIYTVWLKPRTPQNIVIGGGAGAFPPMIGWVAVTGDITLMPVLLFLIIFM WTPPHFWALALFVQTDYAKVGIPMMPVVAGERSTRKQILAYSILLLPLTLVPWWIGGAGA VYGWSALVLGLVFVALSVKVGLRRSVPNDGMLPEKRLFGYSVLYLFVLFGMLVGDRLATV QGWQ
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of heme B (protoheme IX) to heme O by replacing the vinyl group at carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Database Links
Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Novosphingobium aromaticivorans and why is it significant for biotechnology research?

Novosphingobium aromaticivorans is a bacterial species known for its exceptional metabolic versatility, particularly in degrading aromatic compounds derived from lignin and other complex plant materials. This bacterium has gained significant attention in biotechnology due to its unique enzymatic pathways that enable the conversion of biomass aromatics into valuable platform chemicals such as cis,cis-muconic acid (ccMA), which serves as a precursor for commercial plastics production . N. aromaticivorans possesses multiple degradative pathways and exhibits remarkable genetic tractability, making it an excellent chassis for metabolic engineering applications aimed at sustainable chemical production from renewable resources . Studies have demonstrated that engineered strains of N. aromaticivorans can achieve greater than 100% yield of ccMA from aromatic monomers present in liquor derived from alkaline pretreated biomass, highlighting its biotechnological potential .

What is the biological function of protoheme IX farnesyltransferase (ctaB) in bacterial systems?

Protoheme IX farnesyltransferase, encoded by the ctaB gene in bacterial systems, catalyzes the conversion of protoheme IX (heme B) to heme O by adding a farnesyl group to the heme molecule. This enzyme plays a crucial role in the biosynthesis of heme cofactors required for functional cytochrome oxidases, which are terminal enzymes in the respiratory electron transport chain . In bacterial systems, cytochrome oxidases are essential for aerobic respiration, allowing organisms to utilize oxygen as a terminal electron acceptor. The importance of this enzyme is underscored by studies showing that loss of protohaem IX farnesyltransferase activity results in significant respiratory deficits, particularly affecting high-frequency metabolic processes that require robust energy production . The connection between respiratory chain functionality and aromatic compound metabolism makes protoheme IX farnesyltransferase particularly relevant in the context of N. aromaticivorans, which depends on efficient energy generation to support its complex degradative pathways.

How does the respiratory chain in Novosphingobium compare to other bacterial species?

The respiratory chain in Novosphingobium aromaticivorans shares fundamental similarities with other aerobic bacteria but likely possesses distinctive features that contribute to its metabolic versatility. Comparative genomic analyses of Novosphingobium strains reveal that they possess multiple terminal oxidases and respiratory chain components, providing metabolic flexibility under varying environmental conditions . This respiratory diversity enables Novosphingobium species to thrive in environments with fluctuating oxygen levels and contributes to their ability to metabolize diverse aromatic substrates by accommodating different electron flow patterns required for various catabolic pathways . Unlike some bacterial species with simplified respiratory chains, Novosphingobium appears to maintain a more complex respiratory network that supports its degradative capabilities, particularly for recalcitrant aromatic compounds that require specialized enzyme systems and efficient energy coupling .

What are the optimal conditions for expressing recombinant protoheme IX farnesyltransferase from N. aromaticivorans?

When expressing recombinant protoheme IX farnesyltransferase from N. aromaticivorans, researchers should implement a systematic approach to optimize expression conditions. Based on studies with membrane-associated proteins from similar bacterial systems, expression temperatures between 16-20°C typically yield better results than standard 37°C conditions, as lower temperatures reduce protein aggregation and inclusion body formation . The choice of expression system is critical—while E. coli is commonly used, specialized strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) often provide superior results. For induction, IPTG concentrations between 0.1-0.5 mM with extended expression periods (16-24 hours) generally balance protein yield with proper folding.

The following table summarizes key parameters for optimizing expression conditions:

ParameterRecommended ConditionsRationale
Expression temperature16-20°CReduces protein aggregation and promotes proper folding
Expression hostE. coli C41(DE3), C43(DE3), or RosettaStrains engineered for membrane protein expression
Induction0.1-0.5 mM IPTGLower concentrations reduce toxicity while maintaining expression
Expression time16-24 hoursExtended period allows for proper protein folding
Media supplements0.5-1% glucose, 5-10 mM heme precursorsStabilizes plasmids and provides cofactor building blocks
Membrane fraction isolationGentle lysis followed by differential centrifugationPreserves native membrane environment

Importantly, incorporating affinity tags (preferably at the C-terminus to minimize interference with signal sequences) facilitates purification while monitoring expression levels via Western blotting to confirm proper protein production .

What analytical techniques are most effective for characterizing purified protoheme IX farnesyltransferase?

Characterization of purified protoheme IX farnesyltransferase requires a combination of biochemical, biophysical, and functional analytical techniques. Circular dichroism (CD) spectroscopy provides valuable information about secondary structure content and folding integrity, with properly folded enzyme typically showing characteristic α-helical patterns consistent with membrane protein architecture. Thermal shift assays can assess protein stability under various buffer conditions, with optimal formulations typically containing stabilizing agents such as glycerol (10-20%) and appropriate detergent concentrations below their critical micelle concentration .

For functional characterization, activity assays monitoring the conversion of protoheme IX to heme O using HPLC or LC-MS provide direct evidence of enzymatic function. Steady-state kinetic analyses should determine key parameters including Km values for both protoheme IX (typically in the low micromolar range) and farnesyl pyrophosphate substrates, as well as the enzyme's Vmax and catalytic efficiency (kcat/Km). Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can determine the oligomeric state of the purified enzyme in detergent solutions, which is crucial information for understanding its functional mechanism .

How can researchers assess the impact of recombinant protoheme IX farnesyltransferase on cellular respiration in N. aromaticivorans?

Assessing the impact of recombinant protoheme IX farnesyltransferase on cellular respiration in N. aromaticivorans requires a multi-faceted approach combining physiological, biochemical, and genetic methods. Oxygen consumption rate (OCR) measurements using Clark-type electrodes or specialized respirometry systems provide direct quantification of respiratory activity in wild-type versus modified strains. These measurements should be conducted under various growth conditions, particularly comparing growth on simple sugars versus aromatic compounds, to elucidate condition-specific effects .

Membrane potential assessments using fluorescent probes such as JC-1 or DiOC2(3) can reveal changes in the proton motive force resulting from altered cytochrome oxidase functionality. Complementary biochemical assays measuring the activity of individual respiratory chain complexes in membrane preparations can pinpoint specific effects within the electron transport system. For example, studies with cytochrome c oxidase-deficient systems have shown significant impairment of high-frequency activities while maintaining normal function under low-frequency conditions, suggesting differential energy requirements .

Genetic approaches, including controlled expression systems allowing for titration of protoheme IX farnesyltransferase levels, can establish dose-dependent relationships between enzyme activity and respiratory function. When combined with transcriptomic or proteomic analyses, these approaches can reveal compensatory mechanisms that may be activated in response to altered respiratory chain composition .

How does protoheme IX farnesyltransferase influence the aromatic compound degradation pathways in N. aromaticivorans?

Protoheme IX farnesyltransferase likely influences aromatic compound degradation in N. aromaticivorans through its essential role in respiratory chain assembly and function. The degradation of aromatic compounds, particularly lignin-derived substrates, typically involves oxygenase-dependent reactions that require molecular oxygen and efficient electron transfer systems . As protoheme IX farnesyltransferase is crucial for cytochrome oxidase assembly, its activity directly impacts the terminal electron acceptor capacity of the respiratory chain, potentially creating a metabolic link between respiratory efficiency and aromatic compound catabolism.

Studies with N. aromaticivorans have identified multiple aromatic degradation pathways, including those for lignin-derived compounds such as G-diketone (1-(4-hydroxy-3-methoxyphenyl)propane-1,2-dione), which are metabolized through specific enzyme systems like the Lig dehydrogenases . The efficient functioning of these pathways likely depends on proper respiratory chain assembly to maintain redox balance and energy supply. When protoheme IX farnesyltransferase activity is compromised, the resulting limitations in cytochrome oxidase functionality could create bottlenecks in electron flow, potentially leading to redox imbalance that affects the oxidative steps in aromatic catabolism .

Furthermore, research on related systems has demonstrated that cytochrome oxidase deficiency can significantly impair high-frequency metabolic activities while maintaining functionality under low-frequency conditions . This suggests that aromatic compound degradation, which often involves multiple oxidative steps and high energy demand, may be particularly sensitive to changes in respiratory chain composition and efficiency regulated by protoheme IX farnesyltransferase activity.

What role might protoheme IX farnesyltransferase play in the adaptive response of N. aromaticivorans to varying oxygen concentrations?

Protoheme IX farnesyltransferase likely plays a central role in the adaptive response of N. aromaticivorans to varying oxygen concentrations through its influence on terminal oxidase assembly and functionality. In environments with fluctuating oxygen availability, bacteria must adjust their respiratory machinery to maintain energy production efficiency . As protoheme IX farnesyltransferase is essential for the biosynthesis of heme O, a crucial cofactor for cytochrome oxidases, its activity directly impacts the cell's ability to utilize available oxygen.

Genomic analyses of Novosphingobium strains indicate the presence of multiple terminal oxidases with potentially different oxygen affinities . This respiratory flexibility would allow the organism to adapt to microaerobic or oxygen-limited conditions often encountered in its natural habitats. The regulation of protoheme IX farnesyltransferase expression or activity could serve as a control point for modulating the composition of the terminal oxidase pool in response to oxygen availability.

Studies with cytochrome oxidase-deficient systems have demonstrated significant differences in performance under various metabolic loads, with high-frequency activities being particularly affected . This suggests that N. aromaticivorans might regulate protoheme IX farnesyltransferase activity to optimize respiratory chain composition based on both oxygen availability and metabolic demand, particularly when growing on challenging carbon sources like aromatic compounds that require robust energy generation and redox balance maintenance .

What are common challenges in heterologous expression of N. aromaticivorans protoheme IX farnesyltransferase and how can they be overcome?

Heterologous expression of N. aromaticivorans protoheme IX farnesyltransferase presents several challenges that researchers should anticipate and address systematically. Membrane protein misfolding and aggregation constitute the most common difficulties, often resulting in inclusion body formation and low yields of functional protein . This can be mitigated by expressing at reduced temperatures (16-20°C), using specialized expression hosts designed for membrane proteins, and optimizing inducer concentrations. Codon usage differences between N. aromaticivorans and expression hosts can also impede efficient translation; this is best addressed through codon optimization of the synthetic gene or by using hosts with supplemental tRNAs for rare codons.

Another significant challenge involves maintaining enzyme activity during solubilization and purification. Harsh detergents may efficiently extract the protein but often denature it, while milder detergents may preserve activity but extract inefficiently. A methodical screening of detergents (typically starting with maltosides, glucosides, and nonionic options) at various concentrations, combined with stability enhancers such as glycerol and specific lipids, can identify optimal solubilization conditions .

Cofactor incorporation presents another hurdle, as protoheme IX farnesyltransferase requires proper heme association for functionality. Supplementing growth media with δ-aminolevulinic acid (a heme precursor) can enhance cofactor availability, while anaerobic purification conditions may prevent oxidative damage to critical residues . Finally, developing reliable activity assays for validation can be challenging; approaches combining spectrophotometric methods with HPLC or LC-MS confirmation provide the most robust verification of functional enzyme production.

How should researchers interpret conflicting data when analyzing the effects of protoheme IX farnesyltransferase modifications on aromatic compound metabolism?

When confronted with conflicting data regarding the effects of protoheme IX farnesyltransferase modifications on aromatic compound metabolism, researchers should implement a systematic approach to data interpretation that considers multiple experimental variables. First, carefully examine differences in strain backgrounds, as genetic variations beyond the targeted modification may influence results. Second, consider growth conditions—parameters such as oxygen availability, growth phase during analysis, and media composition can dramatically affect respiratory chain function and aromatic metabolism .

The presence of compensatory mechanisms represents another critical consideration. Bacteria often possess redundant respiratory pathways that may mask the effects of single gene modifications, particularly if the experimental timeframe allows for adaptation. Analyzing acute versus chronic responses to protoheme IX farnesyltransferase modification can help distinguish primary effects from compensatory adaptations .

Technical variations in analytical methods must also be scrutinized, as different techniques for measuring enzyme activity, respiratory function, or metabolite production may have distinct sensitivities and limitations. Contradictions might arise from methodological differences rather than biological reality. Additionally, consider potential pleiotropic effects, as alterations in respiratory chain components can broadly impact cellular physiology beyond their direct biochemical role .

To resolve conflicts, design experiments that directly test competing hypotheses using multiple complementary techniques. Global approaches such as metabolomics or transcriptomics can reveal systemic effects that might explain apparent contradictions in targeted analyses. Additionally, constructing isogenic strains with defined, progressive modifications can help establish clear cause-effect relationships by minimizing confounding variables .

What statistical approaches are most appropriate for analyzing the kinetic parameters of recombinant protoheme IX farnesyltransferase?

Analysis of kinetic parameters for recombinant protoheme IX farnesyltransferase requires statistical approaches tailored to the complex nature of membrane-associated enzymes and their reaction environments. For basic kinetic parameter determination, non-linear regression analysis using the Michaelis-Menten equation provides estimates of Km and Vmax, but researchers should verify that model assumptions are met through linearity tests of initial velocity measurements .

The following table outlines appropriate statistical approaches for different kinetic analyses:

Kinetic Analysis TypeRecommended Statistical ApproachKey Considerations
Basic Michaelis-Menten parametersNon-linear regressionVerify reaction linearity; include proper weighting; analyze residuals for systematic patterns
Substrate inhibitionModified equations with inhibition termsTest multiple models (competitive, uncompetitive, mixed); perform model selection using AIC or BIC
Complex kinetic behaviorsHill equation or allosteric modelsEvaluate cooperativity coefficients; compare nested models using F-tests
Comparing enzyme variantsANOVA with post-hoc testsUse Tukey's test for multiple comparisons; report effect sizes with confidence intervals
Time-course stability studiesRepeated measures ANOVA or mixed-effects modelsAccount for within-subject correlation; evaluate different covariance structures
Multi-substrate kineticsGlobal fitting of multiple datasetsDistinguish between sequential and ping-pong mechanisms; evaluate product inhibition

When comparing enzyme variants or conditions, researchers should prioritize reporting not just p-values but also effect sizes and confidence intervals to provide complete statistical context. For complex datasets involving multiple variables, multivariate approaches such as principal component analysis can help identify patterns and relationships that might not be apparent in univariate analyses . Advanced approaches such as bootstrap resampling can provide robust estimates of parameter uncertainty, particularly valuable when working with limited sample sizes or highly variable data characteristic of membrane enzyme assays .

How might CRISPR-Cas9 technology be applied to study the function of protoheme IX farnesyltransferase in N. aromaticivorans?

CRISPR-Cas9 technology offers powerful approaches for investigating protoheme IX farnesyltransferase function in N. aromaticivorans through precise genetic manipulations. A methodological approach would begin with designing guide RNAs targeting the ctaB gene with high specificity, accounting for the unique genomic context of N. aromaticivorans . For complete gene deletion studies, researchers could design constructs that replace the ctaB coding sequence with selectable markers while maintaining genomic context to prevent polar effects on nearby genes.

For more sophisticated studies, CRISPR-Cas9 can be used to introduce point mutations at catalytic residues, creating strains with partial enzyme activity or altered substrate specificity. This approach would allow researchers to dissect structure-function relationships without completely abolishing protein expression. The development of CRISPR interference (CRISPRi) systems for N. aromaticivorans would enable tunable repression of ctaB expression without permanent genetic modifications, allowing for studies of dose-dependent effects and temporal control .

Multiplexed CRISPR approaches could simultaneously target ctaB along with genes encoding other respiratory chain components or aromatic degradation enzymes to explore potential synthetic interactions and functional redundancies. When implementing these CRISPR-based approaches, researchers should develop efficient transformation protocols specific to N. aromaticivorans, optimize promoters for Cas9 expression in this organism, and establish rigorous screening methods to identify and verify genetic modifications . The resulting engineered strains would serve as valuable tools for dissecting the role of protoheme IX farnesyltransferase in respiratory functions and aromatic compound metabolism.

What aspects of protoheme IX farnesyltransferase structure-function relationship should be prioritized for investigation?

Investigation of the protoheme IX farnesyltransferase structure-function relationship should prioritize several key aspects to advance our understanding of this enzyme's role in N. aromaticivorans metabolism. Membrane topology and integration mechanisms represent foundational knowledge, as proper membrane association is critical for enzyme functionality. Determining the number and arrangement of transmembrane helices, along with their roles in protein stability and catalysis, would provide essential structural insights .

Substrate binding mechanisms deserve particular attention, focusing on residues involved in coordinating both protoheme IX and farnesyl pyrophosphate. Structure-guided mutagenesis studies targeting predicted binding sites could identify critical residues and potentially lead to variants with altered substrate specificity or improved catalytic efficiency. Examining the enzyme's potential interactions with other respiratory chain components would illuminate its role within the broader context of cellular respiration, particularly how it interfaces with cytochrome oxidase assembly machinery .

Investigating regulatory mechanisms controlling protoheme IX farnesyltransferase expression and activity would provide insights into how N. aromaticivorans modulates its respiratory chain composition in response to environmental conditions, particularly oxygen availability and carbon source . Additionally, exploring potential allosteric regulation of enzyme activity could reveal how its function is fine-tuned within the cellular context. Comparative structural studies examining protoheme IX farnesyltransferase across different Novosphingobium species that exhibit varied aromatic degradation capabilities might identify structural adaptations that support specialized metabolic functions .

How might systems biology approaches enhance our understanding of the role of protoheme IX farnesyltransferase in aromatic compound metabolism?

Systems biology approaches offer powerful frameworks for integrating multiple levels of biological information to understand the role of protoheme IX farnesyltransferase in the complex metabolic network of N. aromaticivorans. A comprehensive strategy would combine transcriptomics, proteomics, and metabolomics analyses of wild-type and ctaB-modified strains under various growth conditions, particularly focusing on shifts between different carbon sources including aromatic compounds .

Genome-scale metabolic models of N. aromaticivorans, incorporating detailed representations of respiratory chain components and aromatic degradation pathways, could predict how alterations in ctaB expression might propagate through the metabolic network, affecting redox balance, energy generation, and carbon flux distributions. Recent studies have already begun developing such models for related organisms involved in aromatic compound degradation, providing templates that could be adapted for N. aromaticivorans .

Flux balance analysis and metabolic flux analysis using isotope-labeled substrates could reveal how protoheme IX farnesyltransferase activity influences carbon flow through central metabolism and aromatic degradation pathways. These approaches would be particularly valuable for understanding the metabolic adjustments that occur when N. aromaticivorans transitions between growth on simple sugars and complex aromatic compounds .

Network analysis examining protein-protein interactions involving protoheme IX farnesyltransferase might reveal previously unrecognized functional associations with other cellular components. Additionally, comparative systems analyses across multiple Novosphingobium species could highlight evolutionary adaptations in respiratory chain components that correlate with specialized metabolic capabilities, potentially identifying co-evolved systems that support efficient aromatic compound degradation . These integrated approaches would provide a holistic understanding of how protoheme IX farnesyltransferase contributes to the remarkable metabolic versatility of N. aromaticivorans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.