Recombinant Novosphingobium aromaticivorans Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order remarks and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Saro_3184; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)
Target Names
uppP
Target Protein Sequence
MDTIVTAILLGIVEGLTEFLPVSSTGHLILATELFGYDAHQWAMFNVVIQLGAILAVVVQ YWRTFWAVGMGLLRLEPISLRFLRNLLAAFIPSAILGLALKKYIDVLLGSPSVVCWALIA GGIAILVIEKHAKQGEPSGIGQLPLRQAIGVGLAQCLAMVPGVSRSGATIMGALAMGIER RTAAEFSFFLAIPTMLGATTLELLDNRDALLGGTMGVGWSEIGVGFAVSFVVALAVIRLF VAYVSRAGFKPFAWYRIAAGAVALGWLAMR
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Novosphingobium aromaticivorans and why is it significant in research?

Novosphingobium aromaticivorans is a Gram-negative alphaproteobacterium belonging to the Sphingomonodaceae family that has gained research significance due to its ubiquitous environmental presence and unique biological properties. This bacterium is found extensively in the environment, at human mucosal surfaces, and in human feces . Its significance in research spans multiple dimensions, including its association with primary biliary cirrhosis (PBC), its remarkable xenobiotic-metabolizing capabilities that enable it to degrade various environmentally hazardous compounds (including polycyclic aromatics and dioxine compounds), and its unusual cell wall structure containing glycosphingolipids (GSLs) instead of lipopolysaccharides (LPS) . The bacterium has also been associated with autoimmune responses through molecular mimicry mechanisms, making it an important model organism for studying host-pathogen interactions in autoimmune diseases .

What is Undecaprenyl-diphosphatase (uppP) and what are its known functions?

Undecaprenyl-diphosphatase (uppP), classified under EC=3.6.1.27, is an enzyme also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase . In bacterial systems, this enzyme plays a critical role in peptidoglycan biosynthesis by recycling the lipid carrier undecaprenyl pyrophosphate, converting it to undecaprenyl phosphate through dephosphorylation . This recycling process is essential for cell wall synthesis, as undecaprenyl phosphate serves as a carrier for peptidoglycan precursors across the cytoplasmic membrane . The enzyme's function in conferring bacitracin resistance is particularly notable, as bacitracin antibiotics work by binding to undecaprenyl pyrophosphate and preventing its dephosphorylation, thus inhibiting cell wall synthesis . By accelerating the conversion of undecaprenyl pyrophosphate to undecaprenyl phosphate, uppP effectively reduces the target availability for bacitracin, contributing to antibiotic resistance mechanisms in bacteria.

How is the protein structure of Novosphingobium aromaticivorans uppP characterized?

The Undecaprenyl-diphosphatase (uppP) from Novosphingobium aromaticivorans has a specific amino acid sequence that contributes to its functional properties. According to the available data, the protein's sequence includes multiple transmembrane domains, consistent with its role in membrane-associated cell wall synthesis processes . The protein is identified by UniProt accession number Q2G3F4 and contains approximately 270 amino acids in its full-length form .

The protein's structural characterization reveals it contains predominantly hydrophobic regions that facilitate its insertion into the bacterial membrane, with catalytic regions positioned to interact with the pyrophosphate groups of its substrate. Top-down proteomics analyses have demonstrated that periplasmic proteins from N. aromaticivorans, including membrane-associated enzymes like uppP, commonly undergo post-translational modifications (PTMs) such as signal peptide removal, N-terminal methionine excision, acetylation, and disulfide bond formation that are critical for proper folding and function in the periplasmic environment . These modifications contribute significantly to the final tertiary structure and catalytic capabilities of the enzyme.

What are the optimal conditions for expression and purification of recombinant Novosphingobium aromaticivorans uppP?

The expression and purification of recombinant Novosphingobium aromaticivorans uppP requires careful optimization of multiple parameters. Based on research practices for similar recombinant proteins, the expression system of choice appears to be baculovirus, which is particularly effective for membrane proteins . For purification optimization, a Design of Experiment (DoE) approach is highly recommended over traditional one-factor-at-a-time (OFAT) methods, as it provides a more comprehensive understanding of parameter interactions .

For the initial capture step, parameters that typically require optimization include:

ParameterOptimal RangeEffect on Purification
pH2.9-3.0Critical for protein elution while maintaining stability
Trehalose concentration32-35% (w/v)Prevents aggregation and enhances recovery
Loading conductivity5-12.5 mS/cmAffects binding capacity and selectivity
Elution buffer compositionProtein-specificInfluences recovery and purity

For membrane proteins like uppP, additional considerations include the use of appropriate detergents for solubilization and maintaining protein stability throughout the purification process. Cation exchange chromatography at pH near 6.0 has been found effective for similar proteins, followed by gel filtration for final polishing to achieve purities above 95% . This multi-step purification approach, when optimized through DoE, provides robust and reproducible results even when scaled up 20-fold or more .

What are the recommended storage conditions for maintaining stability of purified recombinant uppP?

Maintaining the stability of purified recombinant Novosphingobium aromaticivorans uppP requires careful attention to storage conditions. According to product specifications, the recombinant protein should be stored at -20°C for regular use, while long-term storage at -80°C is recommended for extended preservation . The shelf life of the liquid form is typically limited to approximately 6 months at these temperatures, while lyophilized preparations can remain stable for up to 12 months .

Several critical factors affect stability during storage:

  • Repeated freeze-thaw cycles are particularly detrimental to protein integrity and should be strictly avoided. Instead, the purified protein should be aliquoted into single-use volumes before freezing .

  • For ongoing experiments, working aliquots can be maintained at 4°C for up to one week, but longer periods at this temperature are not recommended due to potential degradation .

  • Buffer composition significantly impacts stability, with optimal formulations typically including stabilizing agents such as glycerol (often at 50% concentration) and reducing agents if the protein contains critical cysteine residues .

  • Prior to use after storage, it is advisable to briefly centrifuge the protein vial to ensure all contents settle at the bottom and then reconstitute lyophilized protein in deionized sterile water to achieve the desired working concentration .

These storage recommendations are critical for maintaining both structural integrity and enzymatic activity of the recombinant uppP protein over time.

How can researchers optimize protein reconstitution methods for uppP functional studies?

For optimal reconstitution of recombinant Novosphingobium aromaticivorans uppP while preserving its functional integrity, researchers should follow a systematic approach. The lyophilized protein should first undergo brief centrifugation to collect all material at the bottom of the vial before opening . Reconstitution should be performed using deionized sterile water to achieve the desired concentration, typically starting with 0.1 mg/ml as a working solution .

The reconstitution process should consider several critical factors:

  • Temperature control: Perform reconstitution at 4°C to minimize protein denaturation and potential aggregation.

  • Gentle mixing: Use slow, gentle inversion or rotation rather than vortexing to prevent protein denaturation.

  • Buffer optimization: For functional studies, the reconstitution buffer should mimic the physiological environment of the periplasmic space where uppP naturally functions. This typically includes:

    • pH maintained between 5.9-6.1, which has been shown to be optimal for similar membrane proteins

    • Inclusion of appropriate detergents at concentrations above their critical micelle concentration to maintain the protein in a soluble, active form

    • Addition of stabilizing agents such as trehalose (32-35%) which has been demonstrated to significantly reduce aggregation

  • Post-reconstitution handling: Following reconstitution, allow the protein solution to equilibrate for 15-30 minutes before use in downstream applications to ensure complete solubilization and proper folding.

These methodological considerations are essential for obtaining functionally active uppP for subsequent enzymatic assays or structural studies.

What are the most effective methods for assessing the purity and integrity of recombinant uppP preparations?

  • Top-down proteomics using Fourier transform mass spectrometry (FTMS) provides unparalleled characterization of the intact protein, allowing simultaneous assessment of purity, verification of the complete sequence, and identification of post-translational modifications (PTMs) . This technique has successfully characterized numerous periplasmic proteins from N. aromaticivorans, revealing important modifications including signal peptide removal and disulfide bond formation .

  • Size Exclusion Chromatography (SEC) effectively separates protein aggregates and contaminants of different molecular weights, providing a complementary purity assessment to SDS-PAGE and information about the protein's oligomeric state.

  • Differential Scanning Fluorimetry (DSF) or Differential Scanning Calorimetry (DSC) to assess thermal stability, which serves as an indirect measure of proper folding.

  • Circular Dichroism (CD) spectroscopy to evaluate secondary structure content, providing further confirmation of proper folding.

  • Dynamic Light Scattering (DLS) to assess homogeneity and detect potential aggregation.

When combined, these techniques provide a comprehensive assessment of protein quality that extends beyond simple purity measurements to include structural integrity and proper folding—critical factors for subsequent functional studies.

How can researchers effectively use Design of Experiment (DoE) approaches for uppP purification optimization?

Design of Experiment (DoE) approaches offer significant advantages over traditional one-factor-at-a-time (OFAT) methods for optimizing the purification of recombinant Novosphingobium aromaticivorans uppP. Based on successful applications with similar proteins, researchers should implement a structured DoE approach as follows:

  • Factor identification phase: Initially identify all potentially relevant factors affecting purification, including pH, salt concentration, buffer type, temperature, and additives such as trehalose . For membrane proteins like uppP, detergent type and concentration are additional critical factors.

  • Screening phase: Employ a 2-level fractional factorial design to efficiently screen these factors with minimal experimental runs, identifying the most significant variables affecting purification outcomes . This typically reduces a complex multi-factor system to 2-3 critical parameters.

  • Optimization phase: For the identified critical factors, implement a central composite circumscribed (CCC) design to precisely map the response surface and identify optimal conditions . For uppP, this might focus on optimizing:

    • pH range (likely between 5.9-6.1 based on similar proteins)

    • Loading conductivity (optimal range typically 5-12.5 mS/cm)

    • Trehalose concentration (32-35% w/v has proven effective for similar proteins)

  • Validation phase: Confirm the predicted optimal conditions with validation runs and assess robustness through small deliberate variations in the identified optimal parameters.

  • Scale-up verification: Critically, validate the optimized conditions through scale-up experiments (typically 20-fold) to confirm that purification performance remains consistent at larger scales .

This systematic approach provides several advantages over traditional methods, including reduced experimental time, comprehensive understanding of factor interactions, statistical confidence in results, and robust performance during scale-up—essential for consistent production of high-quality uppP for research applications.

What techniques are recommended for characterizing post-translational modifications (PTMs) in uppP?

Comprehensive characterization of post-translational modifications (PTMs) in recombinant Novosphingobium aromaticivorans uppP requires an integrated analytical approach. Top-down proteomics analysis using ultra-high pressure liquid chromatography coupled with Fourier transform mass spectrometry (FTMS) has proven particularly powerful for unrestricted PTM characterization of periplasmic proteins from N. aromaticivorans . This approach allows simultaneous detection of multiple modifications without prior assumptions about their nature or location.

The analysis should focus on several key PTMs commonly observed in periplasmic proteins:

  • Signal peptide removal: As a periplasmic protein, uppP likely undergoes N-terminal signal sequence cleavage during translocation across the cytoplasmic membrane .

  • N-terminal methionine excision (NME): Studies of N. aromaticivorans periplasmic proteins have revealed unexpectedly high frequency of NME, which was previously unreported in bacterial periplasm .

  • Disulfide bond formation: Essential for structural stability in the oxidizing periplasmic environment, requiring careful analysis under non-reducing conditions .

  • Other potential modifications including acetylation, glutathionylation, and pyroglutamate formation that have been documented in other periplasmic proteins from this organism .

For comprehensive PTM analysis, researchers should:

  • Compare theoretical and observed molecular weights of the intact protein

  • Analyze fragment ions from MS/MS experiments to precisely locate modifications

  • Employ differential alkylation strategies to specifically identify disulfide bonds

  • Use complementary techniques such as Western blotting with modification-specific antibodies to confirm key PTMs

This multi-technique approach provides essential information about the maturation and final state of the protein as it would exist in its native periplasmic environment.

How does uppP from Novosphingobium aromaticivorans compare with homologous enzymes from other bacterial species?

Undecaprenyl-diphosphatase (uppP) from Novosphingobium aromaticivorans exhibits both conserved features and unique characteristics when compared to homologous enzymes from other bacterial species. As a member of the alphaproteobacteria, N. aromaticivorans uppP shares core catalytic mechanisms with other bacterial phosphatases while displaying distinctive features that reflect its ecological niche and phylogenetic position.

Comparative analysis reveals several notable distinctions:

  • Sequence conservation: N. aromaticivorans uppP maintains the catalytic core domains characteristic of this enzyme family while displaying sequence variations in non-catalytic regions that likely reflect adaptation to the specific membrane composition of this organism, particularly its unusual glycosphingolipid-containing cell wall structure instead of the typical LPS found in most Gram-negative bacteria .

  • Substrate specificity: While the primary function of uppP across bacterial species remains the dephosphorylation of undecaprenyl pyrophosphate, the N. aromaticivorans enzyme may exhibit broader substrate tolerance reflecting this organism's remarkable xenobiotic-metabolizing capabilities and ability to degrade diverse aromatic compounds .

  • Inhibition profiles: The response to bacitracin and other potential inhibitors may differ significantly from homologs in other species, with potential implications for antibiotic resistance mechanisms.

  • Post-translational modifications: The extensive PTM landscape observed in N. aromaticivorans periplasmic proteins, including signal peptide removal, N-terminal methionine excision, acetylation, and disulfide bond formation , suggests that uppP from this organism may undergo a unique pattern of modifications not observed in homologs from better-studied bacterial species.

These comparative insights provide valuable context for researchers using N. aromaticivorans uppP as a model system or developing targeted inhibitors against this enzyme class.

What role might uppP play in Novosphingobium aromaticivorans' association with autoimmune diseases?

The potential role of Undecaprenyl-diphosphatase (uppP) in Novosphingobium aromaticivorans' association with autoimmune diseases, particularly primary biliary cirrhosis (PBC), represents an intriguing research question with significant clinical implications. Current evidence suggests several potential mechanisms through which uppP might contribute to autoimmunity:

  • Molecular mimicry: N. aromaticivorans has been specifically linked to PBC due to its exceptional homology with human pyruvate dehydrogenase complex E2 (PDC-E2), the primary autoantigen in PBC . The bacterium demonstrates 100–1000-fold greater homology with the immunodominant region of human PDC-E2 than any other microorganism studied thus far . While uppP itself is not directly implicated in this mimicry, its role in cell wall synthesis may influence the expression or accessibility of the cross-reactive antigens.

  • Activation of innate immunity: The unique cell wall structure of N. aromaticivorans, containing glycosphingolipids (GSLs) instead of LPS, specifically activates Natural Killer T (NKT) cells . The proper functioning of uppP is essential for maintaining cell wall integrity and composition, potentially affecting the presentation of these immunomodulatory GSLs.

  • Persistence mechanisms: As an enzyme involved in bacitracin resistance, uppP may contribute to the bacterium's ability to establish persistent infection, potentially enabling long-term antigenic stimulation that could break immunological tolerance.

  • Influence on bacterial translocation: Proper cell wall synthesis, dependent on uppP function, may affect the bacterium's ability to translocate from the gut to the liver, where it could trigger autoimmune responses in genetically susceptible individuals.

These potential mechanisms highlight the need for further research into uppP as a possible contributor to the autoimmune pathogenesis associated with N. aromaticivorans infection and as a potential therapeutic target.

How can researchers design effective inhibitors targeting Novosphingobium aromaticivorans uppP?

Designing effective inhibitors targeting Novosphingobium aromaticivorans Undecaprenyl-diphosphatase (uppP) requires a sophisticated structure-based approach combined with detailed understanding of the enzyme's catalytic mechanism. This strategy should follow a systematic research progression:

  • Structural elucidation: While the complete three-dimensional structure of N. aromaticivorans uppP has not been fully characterized, researchers should leverage homology modeling based on related bacterial phosphatases, combined with experimental structural data from techniques such as X-ray crystallography or cryo-EM where available. Particular attention should be paid to the catalytic site architecture and membrane-interacting regions.

  • Catalytic mechanism analysis: Understanding the precise catalytic mechanism, including identification of essential active site residues, metal ion requirements, and the reaction transition state, provides critical insights for inhibitor design. For uppP, this typically involves a two-metal ion catalytic mechanism common to phosphatases in this class.

  • Rational inhibitor design strategies should focus on several promising approaches:

    • Substrate analogs that compete for the active site but resist hydrolysis

    • Transition state mimetics that bind with higher affinity than the substrate

    • Allosteric inhibitors targeting regulatory sites distinct from the catalytic center

    • Covalent inhibitors that form irreversible bonds with active site residues

  • Selectivity considerations: Critical to inhibitor design is achieving selectivity for bacterial uppP over human phosphatases to minimize off-target effects. This can be accomplished by targeting structural features unique to bacterial enzymes or exploiting differences in membrane localization.

  • Inhibitor screening and optimization: Once candidate inhibitors are identified, iterative refinement through medicinal chemistry approaches should optimize:

    • Binding affinity (aim for nanomolar range)

    • Selectivity profile (minimal activity against human enzymes)

    • Physicochemical properties (appropriate for membrane penetration)

    • Metabolic stability (resistance to host degradation mechanisms)

This comprehensive approach to inhibitor design not only advances fundamental understanding of N. aromaticivorans biology but also potentially provides therapeutic leads for addressing infections or autoimmune conditions associated with this organism.

What are the current technical challenges in studying recombinant uppP and how might they be overcome?

Research on recombinant Novosphingobium aromaticivorans Undecaprenyl-diphosphatase (uppP) faces several significant technical challenges that require innovative methodological approaches to overcome:

  • Membrane protein solubility and stability: As an integral membrane protein, uppP presents inherent challenges for expression, purification, and structural studies. These challenges can be addressed through:

    • Systematic screening of detergents and stabilizing agents, with trehalose (32-35% w/v) showing particular promise

    • Application of novel membrane mimetics including nanodiscs, amphipols, or styrene-maleic acid copolymer lipid particles (SMALPs)

    • Fusion protein strategies using highly soluble partners to enhance expression and solubility

  • Functional assay development: Measuring the phosphatase activity of uppP with its native substrate presents technical difficulties due to the hydrophobic nature of undecaprenyl pyrophosphate. Researchers should consider:

    • Development of fluorescent or chromogenic substrate analogs

    • Coupled enzymatic assays that link phosphate release to a detectable signal

    • Mass spectrometry-based assays for direct product detection

  • Structural characterization: Obtaining high-resolution structural data remains challenging. Promising approaches include:

    • Lipidic cubic phase crystallization specifically optimized for membrane proteins

    • Cryo-electron microscopy, particularly single-particle analysis for detergent-solubilized protein

    • Integrative structural biology combining lower-resolution techniques with computational modeling

  • Post-translational modification analysis: Comprehensive PTM characterization requires addressing the challenges of detecting and localizing modifications in membrane proteins through:

    • Top-down proteomics approaches as successfully applied to other N. aromaticivorans periplasmic proteins

    • Development of modification-specific antibodies for Western blotting validation

    • Targeted mass spectrometry methods with enhanced sensitivity for specific modifications

By systematically addressing these technical challenges through innovative methodological approaches, researchers can significantly advance our understanding of uppP structure, function, and biological significance.

How might research on uppP contribute to understanding bacterial resistance mechanisms?

Research on Novosphingobium aromaticivorans Undecaprenyl-diphosphatase (uppP) has significant implications for understanding broader bacterial resistance mechanisms, particularly those involving cell wall biosynthesis pathways. As an enzyme alternatively known as "Bacitracin resistance protein," uppP plays a direct role in counteracting the mechanism of action of bacitracin antibiotics . This connection to antimicrobial resistance provides multiple avenues for research with important clinical implications:

  • Mechanistic insights into bacitracin resistance: Detailed structural and functional characterization of uppP can reveal precisely how increased dephosphorylation of undecaprenyl pyrophosphate reduces sensitivity to bacitracin by limiting the availability of the antibiotic's target molecule . Understanding these molecular details could inform strategies for overcoming or circumventing this resistance mechanism.

  • Cross-resistance implications: Research should investigate whether uppP overexpression or mutations confer resistance to other antibiotics that target different steps in cell wall biosynthesis. Such cross-resistance mechanisms are particularly concerning from a clinical perspective.

  • Environmental adaptation: Given N. aromaticivorans' remarkable ability to degrade xenobiotic compounds , research might explore whether uppP has evolved additional functions related to environmental resilience, potentially revealing novel resistance mechanisms unique to this genus.

  • Inhibitor development: Structure-function studies of uppP can guide the development of small-molecule inhibitors that could potentially resensitize resistant bacteria to bacitracin or serve as standalone antimicrobials. The design of such inhibitors requires detailed understanding of:

    • Catalytic mechanism and essential active site residues

    • Binding mode of substrates and natural inhibitors

    • Species-specific structural features that could be targeted for selective inhibition

These research directions highlight how fundamental studies of uppP contribute to our broader understanding of bacterial resistance mechanisms while potentially informing novel therapeutic strategies.

What are promising future research directions for studying the role of uppP in Novosphingobium aromaticivorans biology?

Future research on Undecaprenyl-diphosphatase (uppP) in Novosphingobium aromaticivorans presents several promising directions that could significantly advance our understanding of this enzyme's role in bacterial biology and potentially lead to novel applications:

  • Systems biology integration: Investigating uppP within the broader context of N. aromaticivorans' metabolic networks could reveal previously unrecognized interactions, particularly given this organism's unusual cell wall composition containing glycosphingolipids instead of LPS . This should include:

    • Transcriptomic analysis to identify co-regulated genes

    • Metabolomic profiling to trace undecaprenyl phosphate utilization

    • Protein-protein interaction studies to map functional complexes involving uppP

  • Environmental adaptation studies: Given N. aromaticivorans' remarkable ability to degrade aromatic hydrocarbons , research should explore whether uppP function is modulated during growth on different carbon sources or exposure to environmental stressors. This could reveal novel regulatory mechanisms and potential biotechnological applications.

  • Host-pathogen interaction investigations: The association between N. aromaticivorans and primary biliary cirrhosis (PBC) presents an opportunity to explore whether uppP contributes to the bacterium's ability to persist in host tissues or modulate immune responses. Specific approaches might include:

    • Mutational analysis to determine the effect of uppP alterations on bacterial survival in host models

    • Immunological studies to assess whether uppP or its products interact with host immune receptors

    • Translocation experiments to determine whether uppP affects the bacterium's ability to move from gut to liver

  • Synthetic biology applications: The xenobiotic-metabolizing properties of N. aromaticivorans combined with uppP's role in cell wall synthesis present intriguing possibilities for engineered strains with enhanced bioremediation capabilities or novel biosynthetic pathways. This might involve:

    • Controlled overexpression or modification of uppP to alter cell wall properties

    • Integration of uppP into synthetic pathways for production of specialized lipid carriers

    • Engineering of uppP variants with altered substrate specificity

These future research directions highlight the multifaceted significance of uppP in N. aromaticivorans biology and its potential applications in biotechnology, medicine, and environmental science.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.