Recombinant Nuclear envelope phosphatase-regulatory subunit 1 homolog (T19A6.3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
nepr-1; T19A6.3; Nuclear envelope phosphatase-regulatory subunit 1 homolog; NEP1-R1; Transmembrane protein 188
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
T19A6.3
Target Protein Sequence
MAIQARRMPEDPSTACEDLKFFEKRLTEVITYMGPTCTRWRIAIVIFAVLVGVIGSKYFA NEKIEIFQIPMIDMFLTTHLDFTLCFFVGLLLFAVFGVHRRIVAPTIVARRCRDALSPFS LSCDHNGKLIVKPAVRNSAP
Uniprot No.

Target Background

Function
This protein may form an active complex with the serine/threonine protein phosphatase scpl-2, dephosphorylating and activating lipin-like phosphatases. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol, regulating fatty acid metabolism. This protein may also play a role in nuclear membrane dynamics, which is crucial for early embryonic development.
Database Links

STRING: 6239.T19A6.3b

UniGene: Cel.16741

Protein Families
CNEP1R1 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Cytoplasm.

Q&A

What is the evolutionary relationship between T19A6.3 and human NEP1-R1?

T19A6.3 represents the C. elegans ortholog of human NEP1-R1 (formerly TMEM188), which was identified as the metazoan ortholog of yeast Spo7p. This evolutionary conservation extends from yeast to humans, indicating the fundamental importance of this protein complex in eukaryotic cellular function. The protein family demonstrates functional conservation across species, as evidenced by complementation studies where human CTDNEP1 and NEP1-R1 can rescue phenotypes in yeast nem1Δ spo7Δ strains .

SpeciesProtein NameFormer/Alternative Names
C. elegansT19A6.3nepr-1
HumanNEP1-R1TMEM188
S. cerevisiaeSpo7p-

What are the basic structural features of T19A6.3 protein?

T19A6.3 is a small protein of 140 amino acids with predicted transmembrane domains that facilitate its insertion into the nuclear envelope membrane. Structural analyses suggest that it adopts a topology similar to other NEP1-R1 family members, with membrane-spanning regions that allow it to function as part of the phosphatase complex. The protein contains hydrophobic regions consistent with its function as a membrane-associated regulatory subunit .

How does T19A6.3 interact with its catalytic partner to regulate lipid metabolism?

T19A6.3 forms a complex with the C. elegans ortholog of CTDNEP1, where T19A6.3 serves as the regulatory subunit while CTDNEP1 functions as the catalytic phosphatase. This complex targets and dephosphorylates lipin-1, a phosphatidic acid phosphatase that catalyzes the conversion of phosphatidic acid to diacylglycerol (DAG). The interaction between T19A6.3 and CTDNEP1 is essential for proper phosphatase activity, as the catalytic subunit alone demonstrates significantly reduced activity in the absence of its regulatory partner .

The dephosphorylation of lipin-1 by the T19A6.3-CTDNEP1 complex leads to:

  • Activation of lipin-1's phosphatidic acid phosphatase activity

  • Regulation of phospholipid synthesis

  • Control of triacylglycerol (TAG) production

  • Influence on lipid droplet formation and dynamics

What role does T19A6.3 play in nuclear envelope dynamics during cell division?

In C. elegans embryos, T19A6.3 (nepr-1) works together with its catalytic partner and lipin-1 to regulate nuclear envelope breakdown after zygote formation. Knockdown studies have demonstrated that reduced expression of T19A6.3, its catalytic partner, or lipin-1 inhibits proper nuclear envelope breakdown during mitosis. This suggests that the diacylglycerol produced through this pathway plays a critical role in nuclear membrane dynamics .

The process involves:

  • T19A6.3-CTDNEP1 complex activation

  • Dephosphorylation and activation of lipin-1

  • Increased production of DAG at the nuclear envelope

  • DAG-mediated changes in membrane properties facilitating nuclear envelope breakdown

  • Progression through mitosis

How is the expression of T19A6.3 coordinated with its functional partners?

The expression pattern of T19A6.3 and its catalytic partner closely mirrors that of lipin-1 across tissues, suggesting coordinated transcriptional regulation of this metabolic pathway. In both human and mouse tissues, NEP1-R1 and CTDNEP1 demonstrate remarkably similar expression profiles to lipin-1, indicating evolutionary conservation of this regulatory relationship. This coordinated expression ensures appropriate stoichiometry of the complex components in tissues where lipid metabolism regulation is critical .

What are the optimal conditions for reconstitution and storage of recombinant T19A6.3 protein?

For optimal handling of recombinant T19A6.3 protein:

  • Initial preparation:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Storage recommendations:

    • Add glycerol to a final concentration of 5-50% (optimal: 50%)

    • Aliquot to minimize freeze-thaw cycles

    • Store at -20°C/-80°C for long-term storage

    • Working aliquots may be stored at 4°C for up to one week

  • Critical considerations:

    • Avoid repeated freeze-thaw cycles as they reduce protein activity

    • Maintain pH 8.0 using Tris/PBS-based buffer with 6% Trehalose for stability

    • When handling the reconstituted protein, minimize exposure to room temperature

What experimental approaches are most effective for studying T19A6.3 interactions with its binding partners?

Several complementary approaches have proven effective for studying T19A6.3 interactions:

  • Co-immunoprecipitation:

    • Express epitope-tagged versions (His-tag, FLAG-tag, or HA-tag) of T19A6.3 and potential binding partners

    • Immunoprecipitate using tag-specific antibodies

    • Analyze complex formation by western blotting

  • Yeast complementation assays:

    • Transform nem1Δ spo7Δ yeast strains with vectors expressing T19A6.3 and its catalytic partner

    • Evaluate restoration of phenotypes (endoplasmic reticulum proliferation, triacylglycerol levels, lipid droplet number)

    • Quantify lipid composition changes via mass spectrometry

  • Fluorescence microscopy:

    • Express fluorescently-tagged fusion proteins

    • Analyze co-localization at the nuclear envelope

    • Evaluate dynamic interactions using FRET or BiFC technologies

How can researchers effectively design knockdown experiments to study T19A6.3 function in C. elegans?

When designing knockdown experiments for T19A6.3 in C. elegans:

  • RNAi approach:

    • Design specific dsRNA targeting non-conserved regions of T19A6.3

    • Implement feeding RNAi protocol using HT115 bacteria expressing dsRNA

    • Ensure specificity by comparing phenotypes with catalytic partner knockdown

  • Phenotypic evaluation:

    • Examine early embryonic divisions for nuclear envelope breakdown defects

    • Analyze lipid droplet formation using lipophilic dyes (BODIPY, Nile Red)

    • Quantify changes in phospholipid and TAG levels using lipidomic approaches

  • Controls and validation:

    • Include parallel knockdowns of known interacting partners (lipin-1, CTDNEP1 ortholog)

    • Perform rescue experiments with RNAi-resistant transgenes

    • Validate knockdown efficiency using RT-qPCR or western blotting

How can researchers distinguish between direct and indirect effects of T19A6.3 manipulation in complex cellular systems?

Distinguishing direct from indirect effects requires a multi-faceted approach:

  • Temporal analysis:

    • Implement time-course experiments after T19A6.3 perturbation

    • Identify primary rapid responses versus secondary adaptive changes

    • Use fast-acting degradation systems (auxin-inducible degron) for acute protein depletion

  • Structure-function analysis:

    • Generate point mutations in key functional domains

    • Create chimeric proteins with homologs from other species

    • Evaluate which specific protein interactions are disrupted by each mutation

  • Pathway dissection:

    • Perform epistasis experiments with other components of the lipid metabolism pathway

    • Use specific lipid pathway inhibitors in combination with T19A6.3 manipulation

    • Implement metabolic labeling to track flux through specific lipid synthesis pathways

What are the methodological challenges in studying T19A6.3 phosphorylation state and activity regulation?

Researchers face several challenges when investigating T19A6.3 phosphorylation and regulation:

  • Detection limitations:

    • T19A6.3 is expressed at relatively low levels in many tissues

    • Phosphorylation events may be transient or affect only a small fraction of the protein pool

    • Available antibodies may not distinguish between phosphorylated and non-phosphorylated forms

  • Activity assay considerations:

    • T19A6.3 functions as a regulatory subunit rather than having direct enzymatic activity

    • Activity must be measured indirectly through CTDNEP1-mediated dephosphorylation of lipin

    • In vitro reconstitution requires proper membrane environment to mimic in vivo conditions

  • Technical approaches to overcome these challenges:

    • Implement phospho-specific antibodies or phospho-proteomics

    • Develop membrane-based reconstitution systems

    • Use phosphomimetic and phosphodeficient mutations to model phosphorylation states

    • Combine with mass spectrometry to identify post-translational modifications

How can quasi-experimental methods be applied to analyze contradictory data in T19A6.3 functional studies?

When confronting contradictory data regarding T19A6.3 function:

  • Difference-in-differences (DID) approach:

    • Compare outcomes between treatment and control groups before and after intervention

    • Control for time-invariant confounders

    • Implement parallel trends assumption testing to validate methodology

  • Handling invalid controls:

    • Identify controls potentially generated by different data-generating processes

    • Implement sensitivity analyses to assess the impact of potentially invalid controls

    • Consider synthetic control methods to create more appropriate counterfactuals

  • Model specification:

    • Test multiple model specifications to assess robustness

    • Address challenges in correctly modeling temporal changes, especially with limited data duration

    • Implement simulation studies to evaluate method performance under various scenarios

What lipidomic approaches are most appropriate for measuring T19A6.3 impact on cellular lipid composition?

Comprehensive lipidomic analysis of T19A6.3-mediated effects should include:

  • Mass spectrometry-based approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for targeted lipid analysis

    • Shotgun lipidomics for broad lipid class profiling

    • Stable isotope labeling to track metabolic flux through DAG and TAG pathways

  • Quantification parameters:

    • Measure absolute changes in phosphatidic acid, DAG, and TAG levels

    • Analyze phospholipid species composition, particularly in nuclear membrane fractions

    • Evaluate fatty acid composition of affected lipid classes

  • Subcellular fractionation:

    • Isolate nuclear envelope fractions to detect localized lipid changes

    • Compare lipid compositions across cellular compartments

    • Implement in situ lipid imaging using fluorescent lipid sensors

Lipid ClassAnalytical MethodExpected Change with T19A6.3 Dysfunction
Phosphatidic acidLC-MS/MSIncrease due to reduced conversion to DAG
DiacylglycerolLC-MS/MSDecrease due to reduced PA phosphatase activity
TriacylglycerolLC-MS/MS, TLCDecrease in lipid droplet formation
Nuclear phospholipidsSubcellular fractionation + MSAltered composition, possible membrane expansion

How can researchers integrate T19A6.3 functional data with broader metabolic pathway analysis?

Integration of T19A6.3 data with metabolic pathways requires:

  • Multi-omics approaches:

    • Combine lipidomics with transcriptomics to identify compensatory gene expression changes

    • Integrate proteomics to detect alterations in interacting protein networks

    • Implement metabolomics to identify broader metabolic consequences

  • Network analysis:

    • Map T19A6.3 effects onto known lipid metabolism pathways

    • Identify potential feedback mechanisms and regulatory nodes

    • Develop computational models incorporating enzymatic kinetics and regulatory interactions

  • Systems biology framework:

    • Generate testable hypotheses about pathway interconnections

    • Predict metabolic outcomes of T19A6.3 perturbation under different nutritional conditions

    • Design targeted validation experiments for key pathway interactions

What are the most promising future research directions for T19A6.3 and related proteins?

Based on current understanding, several promising research directions emerge:

  • Structural biology approaches:

    • Determine high-resolution structures of T19A6.3 alone and in complex with CTDNEP1

    • Elucidate the molecular basis for regulatory interactions

    • Identify potential small molecule binding sites for functional modulation

  • Developmental and tissue-specific functions:

    • Investigate roles in specific developmental processes beyond early embryogenesis

    • Examine tissue-specific functions, particularly in metabolically active tissues

    • Explore potential roles in stress responses and nutrient limitation scenarios

  • Disease relevance:

    • Investigate potential connections to lipodystrophy, similar to lipin-1 mutations

    • Explore roles in nuclear envelope-related disorders

    • Examine potential metabolic disease associations through human genetic studies

What methodological advances would enhance T19A6.3 research?

Future methodological developments that would benefit T19A6.3 research include:

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize nuclear envelope localization with greater precision

    • Live-cell imaging with improved temporal resolution to capture dynamic interactions

    • Correlative light and electron microscopy to connect molecular interactions with ultrastructural changes

  • Genome editing approaches:

    • CRISPR-Cas9 modifications to introduce tagged versions at endogenous loci

    • Creation of conditional knockout models for tissue-specific functional analysis

    • Development of engineered protein variants with tunable activity

  • In vitro reconstitution systems:

    • Membrane-based reconstitution of the complete phosphatase complex

    • Development of activity assays to directly measure regulatory effects on phosphatase activity

    • High-throughput screening systems to identify modulators of complex activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.