Recombinant Nucleoporin ndc-1 (npp-22)

Shipped with Ice Packs
In Stock

Description

Molecular Architecture of Ndc-1

Ndc-1 is an integral membrane protein with distinct domains enabling its dual role in NPC assembly and membrane integration:

DomainFunctionSource
Transmembrane regionsAnchors Ndc-1 within the pore membrane of the nuclear envelope
Amphipathic helix (C-term)Mediates interactions with inner ring scaffold nucleoporins (e.g., Nup53, Nup59)
Luminal/extracellular loopsFacilitates binding to membrane-curvature regulators (e.g., Brl1-Apq12-Brr6 complex)

Structural studies in C. elegans and yeast reveal that Ndc-1’s amphipathic helix is essential for stabilizing outer ring components like the Y-complex (Nup160, Nup133) and inner ring nucleoporins (Nup53) .

NPC Density and Nuclear Size Regulation

  • Loss of Ndc-1 reduces NPC density by ~50% in C. elegans embryos, as shown by electron tomography (26 vs. 51 NPCs/μm² in mutants vs. controls) .

  • Genetic analyses demonstrate that Ndc-1 acts in parallel with Nup53 to control NPC assembly, independent of membrane biogenesis pathways .

Stabilization of Scaffold Components

  • Fluorescence recovery after photobleaching (FRAP) assays show Ndc-1 immobilizes the Y-complex (Nup160:GFP mobility increases from 20% to 47% in ndc1Δ) .

  • Depletion of Ndc-1 reduces nuclear rim localization of scaffold nucleoporins (Nup107, Nup155) without affecting total protein levels .

Key Binding Partners

  • Nup53/Nup59: Collaborate with Ndc-1 to anchor the NPC scaffold; deletion of NUP59 exacerbates Ndc-1ΔAH defects .

  • Pom34/Pom152: Transmembrane nucleoporins that partially compensate for Ndc-1 loss in yeast .

Phenotypic Consequences of Ndc-1 Depletion

PhenotypeObservationSource
Reduced nuclear importDelayed accumulation of GFP:NLS-LacI (50% slower in ndc1Δ embryos)
Mitotic defectsAberrant NE "flare" morphology and SPB duplication failure
Cancer cell suppressionDownregulation inhibits PCNA, CYCLINB1, and Wnt/β-catenin signaling

Disease Relevance and Therapeutic Potential

  • Oncogenic signaling: Ndc-1 promotes NSCLC progression via Wnt/β-catenin activation; silencing reduces tumorigenicity in xenografts .

  • Apoptosis modulation: Ndc-1 knockdown upregulates pro-apoptotic factors (Caspase-3, TP53) in lung cancer models .

Open Questions and Future Directions

  • How does Ndc-1 coordinate with Nup53/Nup59 during interphase NPC assembly?

  • Can recombinant Ndc-1 reconstitute NPC subcomplexes in vitro to study membrane curvature mechanics?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please include it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
npp-22; ndc-1; CBG29121; Nucleoporin ndc-1; Nucleoporin npp-22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
npp-22
Target Protein Sequence
MMGENSSAYTTLADNQLYNQFSPSRRKADLIASTSATSSPNLRKSPNRGFSSPRAQQKPI TIFDQIVSWFHSEIDVRKKLASFVCGAAVALSFIVTVSILKLSIWAPFSSVQDSLTWWLY PTSWPVTLFIWLSSVAWTFLIIHQFCTVTQVPRIPITDTYAWAGAALEFVHRLIFVYTAF TVSESSFFEDFAWIAIAFSVAISSALVIFRSDFHLNFSNVQVNSFKTLIDFAKSLPYGSL AETSGVDAAIAYTAAMALTVFGSPLLWGFSAWWLLINIQFHLVLFGVCFAQQFFAKIFMK IVNQIVMKPMKFPFPPPYTVHSPTPDQIRTLPNVIETDDPLLKMFALHDLRTVAWEDEKR RVDVFSLSQPGKHPRNWKAVSMPCTRMLDELCSRMTVSAARLVGYSWDDHDVENEEVPRD ALMMPRKMREMTYRGAGQSRQQKTIAPIRSNNTQTVGFLAKITRNLGLGKTERLVISRFD AQQNAYAAEAVYMLVVDSMGEDRFGVVQKDLKDLITLLCKLIAAIDTYERAKASVADKSD VTYLRLVDASLKSCLQRVVTTFGSHLRSLELADEHIRTIKLVCAEEI
Uniprot No.

Target Background

Function
Nucleoporin ndc-1 (npp-22) is a component of the nuclear pore complex (NPC), which plays a crucial role in the de novo assembly and insertion of the NPC into the nuclear envelope.
Database Links

STRING: 6238.CBG29121

Protein Families
NDC1 family
Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Nucleoporin ndc-1 (npp-22) and where is it localized within cells?

Nucleoporin ndc-1 (known as npp-22 in C. elegans) is an integral membrane nucleoporin that spans the nuclear envelope double membrane. It serves as one of the few transmembrane components of the nuclear pore complex (NPC) . Located exclusively at the nuclear envelope, npp-22/ndc-1 remains firmly associated with the nucleus even under conditions where other nucleoporins may become displaced . Structurally, it contains transmembrane domains that anchor it within the nuclear envelope, allowing it to interact with both the lipid bilayer and other nucleoporins. Unlike cytoplasmic nucleoporins such as NPP-9, which can sometimes be detected in the cytoplasm when NPC clustering is compromised, GFP-tagged NPP-22 consistently maintains its nuclear envelope localization .

How does ndc-1/npp-22 contribute to nuclear pore complex assembly?

Ndc-1 plays a critical role in coordinating nuclear pore complex assembly with nuclear envelope formation and growth. Research using 3D-EM tomography in C. elegans embryos has established that Ndc-1 determines NPC density during nuclear envelope reformation . It functions as an anchor for the outer scaffold components of the NPC, as evidenced by the faster turnover of Nup160 (an outer scaffold nucleoporin) in the nuclear envelope when ndc-1 is depleted . Fluorescence recovery after photobleaching (FRAP) experiments have shown that approximately 80% of Nup160:GFP remains immobile in the nuclear envelope under normal conditions, but this immobile fraction decreases significantly to around 53% when ndc-1 is depleted, indicating that Ndc-1 is necessary for stable incorporation of the outer ring scaffold .

What phenotypes emerge when ndc-1/npp-22 is depleted or mutated?

Depletion of ndc-1 leads to multiple phenotypes affecting nuclear structure and function. Electron microscopy studies reveal that nascent nuclear envelopes in ndc-1Δ embryos contain approximately 4.8-fold fewer NPC-sized holes compared to controls (11 versus 55 'NPC' holes per μm²) . Additionally, nuclei lacking ndc-1 exhibit slower nuclear expansion rates and reduced nuclear import capacity . Transmission electron microscopy (TEM) of cells lacking both Ndc1p and Pom152p shows nuclear envelopes containing pores with larger diameters than wild-type NPCs and without apparent protein material . This morphological change correlates with increased passive diffusion of proteins normally excluded by intact NPCs, suggesting compromised NPC barrier function . Significantly, complete nuclear envelope formation fails in the absence of both Ndc1 and the inner ring component Nup53, indicating partially redundant roles in NPC assembly .

What are effective techniques for visualizing and quantifying ndc-1/npp-22 dynamics in living cells?

Fluorescence imaging of tagged ndc-1/npp-22 provides valuable insights into its dynamics and function. Researchers have successfully employed endogenously tagged Ndc1 en:mNG (mNeonGreen) to track its mobility and localization in the nuclear envelope . For dynamic studies, Fluorescence Recovery After Photobleaching (FRAP) represents an essential technique that has revealed important differences in Ndc1 mobility between expanding embryonic nuclei and mature oocyte nuclei . In expanding nuclei, Ndc1 shows considerable mobility (mobile fraction approximately 0.59 ± 0.09), while in mature oocyte nuclei, it becomes largely immobile (mobile fraction reduced to 0.22 ± 0.2) .

For quantitative assessment of NPC density and distribution, 3D electron microscopy tomography offers high-resolution visualization of nuclear pores. This approach allows researchers to distinguish between small gaps (<100 nm, potential NPCs) and larger discontinuities in the nuclear envelope . Analysis should focus on nascent nuclear membranes wrapped around the outer edges of chromatin (the 'non-core' region) during nuclear reformation to accurately assess early NPC assembly dynamics .

How can researchers effectively create and validate genetic knockdowns or knockouts of ndc-1/npp-22?

For studying ndc-1/npp-22 function, researchers have successfully employed both RNAi-based knockdowns and genetic mutants. When designing genetic depletion experiments, it's essential to consider the partial redundancy between ndc-1 and other nucleoporins, particularly nup53 . Complete knockout approaches should be approached with caution since simultaneous loss of both ndc-1 and nup53 leads to failed nuclear envelope formation .

For RNAi experiments, validation of knockdown efficiency should include both phenotypic assessment (nuclear import assays using GFP-NLS reporters) and direct measurement of protein depletion through immunoblotting or immunofluorescence . Temperature-sensitive assays may provide additional sensitivity for detecting partial loss-of-function effects, as demonstrated in screens for enhanced piRNA silencing at elevated temperatures (25°C) .

When creating genetic mutants, researchers should consider analysis of allelic series rather than relying solely on complete loss-of-function, as different domains of ndc-1/npp-22 may contribute differently to its multiple functions in NPC assembly and stability .

What experimental systems provide the best models for studying recombinant ndc-1/npp-22 function?

C. elegans embryos offer an exceptional experimental system for studying ndc-1/npp-22 function during nuclear formation and expansion. The stereotypical first division of early C. elegans embryos provides an ideal context to examine the direct effects of Ndc1 depletion on nuclear formation and expansion without confounding effects from multiple rounds of division . Furthermore, C. elegans lacks Pom121 (another transmembrane nucleoporin present in mammals), allowing researchers to investigate the specific contribution of Ndc1 in NPC biogenesis independent of Pom121 .

For studying the interplay between nuclear pore complexes and germline development, C. elegans germline offers additional advantages. The germline syncytium allows visualization of perinuclear germ granules and their association with nuclear pore complexes . This system has been particularly valuable for uncovering connections between nucleoporins and small RNA pathways involved in gene silencing .

When expressing recombinant ndc-1/npp-22, it's important to consider its transmembrane nature, which can present challenges for traditional protein expression systems. Endogenous tagging approaches, such as the Ndc1 en:mNG system used in C. elegans studies, may offer advantages for maintaining physiological expression levels and protein folding .

How does ndc-1/npp-22 coordinate with membrane biogenesis during nuclear expansion?

Ndc-1 functions in parallel with membrane biogenesis pathways to regulate nuclear size and NPC density. Research using a mutant strain in cnep-1 (a negative regulator of ER and nuclear membrane biogenesis) demonstrated that increased membrane biogenesis results in faster nuclear envelope expansion . Interestingly, upregulation of membrane synthesis partially suppressed the slow nuclear expansion rate resulting from loss of ndc-1, but did not restore the reduced nuclear import capacity or NPC density . This selective suppression indicates that membrane production can be decoupled from Ndc1-mediated NPC assembly to drive nuclear growth independently .

In contrast, upregulated membrane biogenesis failed to restore the small nuclear size resulting from loss of nup53 or nup153, suggesting these nucleoporins are required for membrane-driven nuclear expansion in ways that ndc-1 is not . This differential response highlights the complex relationship between membrane incorporation and NPC assembly during nuclear envelope formation and growth. It suggests that while ndc-1 primarily influences NPC density by stabilizing outer ring components, other nucleoporins like nup53 may play more direct roles in coupling membrane addition to functional nuclear expansion .

What interactions exist between ndc-1/npp-22 and other nucleoporins in the nuclear pore complex?

Ndc-1/npp-22 engages in critical interactions with multiple nucleoporin subcomplexes to facilitate NPC assembly. Genetic analyses have revealed parallel functional pathways involving ndc-1 and nup53, possibly converging on Nup155, an essential linker of the NPC scaffold . The relationship between ndc-1 and nup53 is particularly significant, as nuclear envelope formation completely fails in the absence of both proteins, suggesting partially redundant roles in NPC assembly .

Within the NPC structure, ndc-1 appears to function primarily in anchoring the outer ring scaffold components, exemplified by its effect on Nup160 stability . FRAP experiments demonstrated that loss of ndc-1 results in a greater than twofold increase in the mobile fraction of Nup160:GFP in the nuclear envelope, indicating that Nup160:GFP is less stably incorporated without Ndc1 . This anchoring function is consistent with the observation that Ndc1 itself becomes increasingly immobile as nuclear pores mature, with its mobile fraction decreasing from approximately 0.59 in expanding embryonic nuclei to 0.22 in mature oocyte nuclei .

Interestingly, in yeast (S. cerevisiae), Ndc1p functionally overlaps with another transmembrane nucleoporin, Pom152p. Depletion of Ndc1p alone leads to partial mislocalization of NPC components, but this phenotype is significantly worsened when Pom152p is also absent . This suggests evolutionary conservation in the partially redundant roles of transmembrane nucleoporins in NPC assembly and stability.

How do nucleoporins like ndc-1/npp-22 influence RNA processing and gene regulation?

Nucleoporins including ndc-1/npp-22 play unexpected roles in RNA processing and gene regulation beyond their structural functions in nuclear transport. Recent research has uncovered connections between nucleoporins and small RNA pathways, particularly in germline contexts. In C. elegans, nucleoporins NPP-14 (NUP-214) and NPP-24 (NUP-88), components of the cytoplasmic filaments of NPC, play critical roles in anchoring germ granules to NPCs and in attenuating piRNA silencing .

While the direct role of ndc-1/npp-22 in RNA processing is less characterized than these cytoplasmic nucleoporins, its function as a transmembrane anchor for the NPC likely contributes to proper spatial organization of perinuclear RNA processing centers. The precise arrangement of NPCs influences the distribution of perinuclear germ granules, which contain factors involved in small RNA pathways . Disruption of NPC organization through mutation of nucleoporins can lead to fewer but enlarged, unorganized germ granules, accompanied by the over-amplification of secondary small RNAs at piRNA targeting sites .

This spatial reorganization has functional consequences for gene silencing pathways. For example, RNAi targeting several nucleoporin genes, including npp-14 and npp-24, significantly increased piRNA reporter silencing at elevated temperatures . These findings suggest that the structural integrity of the NPC, to which ndc-1/npp-22 is essential, plays important roles in regulating RNA processing and gene silencing pathways.

What are the key considerations when interpreting phenotypes resulting from ndc-1/npp-22 depletion?

When interpreting phenotypes resulting from ndc-1/npp-22 depletion, researchers must carefully consider several factors. First, the partial redundancy between ndc-1 and other nucleoporins, particularly nup53, means that single depletion experiments may underestimate the full functional importance of ndc-1 . Complete nuclear envelope formation failure only occurs when both ndc-1 and nup53 are absent, highlighting the importance of examining combinatorial depletions .

Second, the timing of observation is critical. The direct effects of ndc-1 depletion are best assessed during the first attempt at nuclear formation and expansion, as later observations may reflect accumulated defects from multiple rounds of division . This is exemplified by previous work showing that Ndc1 is only partially essential in C. elegans, but the focus on late-stage embryos made it difficult to distinguish direct versus accumulated effects .

Third, researchers should independently assess multiple aspects of nuclear function rather than relying on a single readout. Measurements should include:

  • Nuclear growth rates through time-lapse microscopy

  • Nuclear import capacity using GFP-NLS reporters

  • NPC density through high-resolution imaging

  • Mobile fractions of other nucleoporins using FRAP

  • Nuclear envelope continuity through electron microscopy

Each of these parameters may respond differently to ndc-1 depletion, providing a more complete picture of its multifaceted roles in nuclear envelope formation and function .

How can researchers distinguish between direct effects of ndc-1/npp-22 manipulation and secondary consequences?

Distinguishing direct effects of ndc-1/npp-22 manipulation from secondary consequences requires careful experimental design and controls. One approach is to use rapid depletion methods such as auxin-inducible degradation rather than relying solely on RNAi or genetic knockouts, which may allow compensatory mechanisms to develop .

Temporal analysis is also critical. For example, studies in C. elegans embryos show that loss of ndc-1 results in both slower nuclear expansion and reduced nuclear import capacity . By testing whether upregulation of membrane biogenesis can rescue these phenotypes, researchers demonstrated that the expansion defect could be partially suppressed while import defects remained, indicating separate mechanisms .

To determine whether a phenotype is directly linked to ndc-1 function or represents a secondary consequence, researchers should:

  • Perform rescue experiments using wild-type and domain-specific mutant versions of ndc-1

  • Test genetic interactions with known functional partners like nup53

  • Examine phenotypes at multiple timepoints to distinguish immediate from accumulated effects

  • Use structure-function analysis to correlate specific domains with particular phenotypes

  • Employ proximity labeling techniques to identify direct molecular interactions

These approaches can help distinguish primary functions of ndc-1/npp-22 from downstream consequences of nuclear envelope or transport dysfunction .

What comparative data exists on ndc-1/npp-22 function across different model organisms?

Model Organismndc-1/npp-22 NomenclatureKey Functional CharacteristicsPhenotypes of DepletionInteracting PartnersResearch Advantages
C. elegansNPP-22Transmembrane nucleoporin exclusively localized to nuclear envelope; determines NPC densitySlower nuclear expansion; reduced nuclear import; fewer NPCs; unstable incorporation of outer scaffold nucleoporinsNup53; Nup160; Nup155Stereotypical first embryonic division; absence of Pom121 allows study of Ndc1-specific functions
S. cerevisiae (Yeast)Ndc1pIntegral membrane nucleoporin; important for NPC assembly and transportPartial mislocalization of NPC components; perturbed nuclear transport; enlarged pore diameters when combined with Pom152p lossPom152p; Pom34pGenetic tractability; simplified NPC structure
DrosophilaNdc1Component of annulate lamellae (specialized ER with NPC components)Not fully characterized in search resultsComponents of annulate lamellaeStudy of preassembled nucleoporin condensates in cytoplasm
MammalsNDC1Transmembrane nucleoporin essential for postmitotic NPC assemblyNot detailed in search resultsPom121 (another transmembrane nucleoporin absent in C. elegans)Relevant to human disease mechanisms

This comparative analysis highlights both conserved and divergent aspects of ndc-1/npp-22 function across evolution. In all systems, it serves as a critical transmembrane component anchoring the nuclear pore complex, but specific functional partnerships and the severity of depletion phenotypes vary . The presence of partially redundant transmembrane nucleoporins (like Pom121 in mammals or Pom152p in yeast) creates system-specific differences in the consequences of ndc-1/npp-22 manipulation .

What emerging technologies could advance our understanding of ndc-1/npp-22 function?

Several emerging technologies hold promise for deeper insights into ndc-1/npp-22 function:

  • Cryo-electron tomography of intact nuclear pores: Higher resolution structural studies could reveal precisely how ndc-1/npp-22 anchors the NPC within the nuclear membrane and interacts with other nucleoporins at the molecular level .

  • Proximity labeling approaches: Techniques like BioID or APEX2 could identify proteins in close proximity to ndc-1/npp-22 within the nuclear envelope, potentially uncovering new functional interactions. This approach has already proven valuable in identifying germ granule factors that contribute to germ granule-NPC interactions .

  • Optogenetic manipulation: Developing tools for acute, spatially restricted disruption of ndc-1/npp-22 function could help distinguish immediate consequences from adaptive responses and provide insights into local versus global roles at the nuclear envelope .

  • Single-molecule tracking: Super-resolution microscopy combined with single-particle tracking could reveal the dynamics of individual ndc-1/npp-22 molecules during NPC assembly and nuclear envelope growth, potentially uncovering heterogeneity in behavior not detectable with ensemble measurements like FRAP .

  • Integrative multi-omics approaches: Combining proteomics, transcriptomics, and functional genomics could reveal broader cellular responses to ndc-1/npp-22 manipulation and place its functions within comprehensive cellular networks .

These technologies would complement existing approaches and potentially resolve current gaps in understanding how ndc-1/npp-22 coordinates NPC assembly with nuclear envelope formation and growth .

How might research on ndc-1/npp-22 inform our understanding of nuclear organization and disease mechanisms?

Research on ndc-1/npp-22 has broader implications for understanding nuclear organization and disease mechanisms. The discovery that ndc-1 functions in parallel with membrane biogenesis to control nuclear size suggests potential mechanisms underlying nuclear size dysregulation in cancer and other diseases . The role of ndc-1 in maintaining proper NPC density may also inform our understanding of neurodegenerative disorders associated with nucleoporin dysfunction .

Furthermore, the unexpected connection between nucleoporins and small RNA pathways revealed in C. elegans points to potential roles for the nuclear pore complex in epigenetic regulation and gene silencing . Disruption of nucleoporin NPP-14 or NPP-24 led to enhanced piRNA silencing but dampened RNAi efficiency and RNAi inheritance, suggesting a role for proper nucleoporin function in balancing different small RNA pathways . While these studies focused on NPP-14 and NPP-24 rather than ndc-1/npp-22 directly, they highlight the importance of the nuclear pore complex architecture, which depends on ndc-1/npp-22, in gene regulatory mechanisms .

As research progresses, a deeper understanding of how ndc-1/npp-22 contributes to nuclear envelope integrity, nuclear pore complex assembly, and potentially gene regulation may provide insights into fundamental mechanisms underlying cellular homeostasis and disease pathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.