Recombinant Nucleoside-triphosphatase ntp-1 (ntp-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ntp-1; C33H5.14; Nucleoside-triphosphatase ntp-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-485
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
ntp-1
Target Protein Sequence
MSGGSSERVQRSVRSVVETKNNIKYGVICDAGSSGTRLFVYTLKPLSGGLTNIDTLIHES EPVVKKVTPGLSSFGDKPEQVVEYLTPLLRFAEEHIPYEQLGETDLLIFATAGMRLLPEA QKDAIIKNLQNGLKSVTALRVSDSNIRIIDGAWEGIYSWIAVNYILGRFDKENDSKVGMI DMGGASVQIAFEIANEKESYNGGNVYEINLGSIETNEDYKYKIYSTTFLGYGANEGLKKY ENSLVKSGNSNDSCSPRGLNRLIGEFTVNGTGEWDVCLAQVSSLIGDKAQPSCPNPTCFL RNVIAPSVNLSTVQLYGFSEYWYTTSNFGSGGEYHYQKFTDEVRKYCQKDWNDIQDGFKR NEFPNADIERLGTNCFKAAWVTSVLHDGFNVDKTKHLFQSVLKIAGEEMQWALGAMLYHS KDLKFNLLEQLEVAQSTQQISNFFSFFVILIIVLAVALYRQLQSESTYKKYNFLRTDSKP DFLNV
Uniprot No.

Target Background

Function
Hydrolyzes CTP, ATP, and UTP.
Database Links
Protein Families
GDA1/CD39 NTPase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is nucleoside-triphosphatase NTP-1 and what is its primary function?

Nucleoside-triphosphatases (NTPases) are enzymes that catalyze the hydrolysis of nucleoside triphosphates into their monophosphate forms and pyrophosphate. NTP-1 belongs to this family of enzymes that play crucial roles in maintaining nucleotide pool balance. These enzymes are fundamental for the precise regulation of DNA synthesis through controlling the size and composition of deoxyribonucleoside triphosphate (dNTP) pools . The primary function of NTPases like NTP-1 involves catabolic activities that convert nucleoside triphosphates to their monophosphate forms, which directly influences DNA synthesis accuracy and genetic stability in both nuclear and mitochondrial genomes .

What structural characteristics define NTPases like NTP-1?

NTPases exhibit diverse structural characteristics depending on their specific subfamilies. For example, DCTPP1, a human NTP pyrophosphatase, is characterized as an all-α nucleotidohydrolase . The structural elements often include:

  • Conserved nucleotide-binding domains

  • Metal ion coordination sites (frequently Mg²⁺)

  • Specific substrate recognition motifs

  • Domain architecture that facilitates conformational changes during catalysis

The detailed structure is typically determined through X-ray crystallography or cryo-electron microscopy, revealing the spatial arrangement that enables these enzymes to discriminate between different nucleotide substrates .

How are NTPases distributed within cellular compartments?

NTPases show specific subcellular localization patterns that reflect their specialized functions. For instance, DCTPP1 has been found to be ubiquitously distributed in the nucleus, cytosol, and mitochondria . This multi-compartment distribution enables these enzymes to regulate nucleotide pools throughout different cellular domains, ensuring proper DNA replication and repair in various cellular compartments.

What are the standard methods for measuring NTPase activity?

NTPase activity can be measured through several established assays, with the following being particularly valuable for research applications:

Radioactive-based ATPase assay:

  • Reaction conditions: 20 mM Tris-HCl (pH 7.5), 2 mM MgCl₂, 1 mM β-mercaptoethanol, 10% glycerol, 0.01% Triton X-100, 0.1 mg BSA/ml

  • Substrate: [γ-³³P]ATP (9.5 μM, 0.025 μCi)

  • Incubation: 30 minutes at 30°C

  • Detection: Activated charcoal precipitation and scintillation counting

This method allows precise quantification of the released inorganic phosphate, providing direct measurement of enzymatic activity. The reaction is typically performed with approximately 2 pmol of purified enzyme in a total volume of 25 μl .

How can researchers purify recombinant NTPases for in vitro studies?

Purification of recombinant NTPases typically follows a multi-step chromatographic approach:

  • Size exclusion chromatography: Initial separation using Superdex-200 columns with buffer containing Tris-HCl, glycerol, detergent, EDTA, and reducing agent

  • Affinity chromatography: Reactive Red 120 column with KCl gradient elution

  • Concentration step: Ultrogel hydroxyapatite column

The purification progress can be monitored by:

  • Activity assays at each step

  • SDS-PAGE analysis

  • Immunoblotting with specific antibodies

  • N-terminal sequencing to confirm protein identity

This multi-step approach typically yields highly purified enzyme preparations suitable for biochemical and structural characterization.

What techniques can identify the active site residues of NTPases?

Identification of active site residues can be accomplished through several complementary approaches:

Chemical modification studies:

  • 5'-[¹⁴C]fluorosulfonylbenzoyladenosine (FSBA) labeling to identify ATP-binding residues

  • Protection studies with substrate analogs to confirm specificity

  • Analysis by SDS-PAGE and autoradiography

Site-directed mutagenesis:

  • Systematic alteration of conserved residues

  • Activity analysis of mutant proteins

  • Correlation of structural and functional data

The FSBA labeling technique has proven particularly valuable, as it covalently modifies residues in the nucleotide-binding site, enabling direct identification of amino acids crucial for catalysis .

What is the substrate specificity profile of nucleoside triphosphatases?

NTPases exhibit distinct substrate preference patterns that define their biological functions. For example, DCTPP1 demonstrates activity toward:

SubstrateRelative ActivityKm (μM)
dCTPHigh-
methyl-dCTPHigh-
5-halogenated nucleotidesHigh-
5-formyl-dCTPVery highLowest Km observed

The extensive characterization of DCTPP1 revealed that it hydrolyzes 5-formyl-dCTP with remarkable efficiency, exhibiting the lowest Km value described for this enzyme . This substrate specificity profile suggests a role in preventing the incorporation of modified nucleotides that could compromise genomic integrity.

How are the kinetic parameters of NTPases determined?

Kinetic characterization of NTPases involves rigorous analysis of their catalytic properties:

  • Steady-state kinetics: Determination of Km, Vmax, and kcat through initial velocity measurements at varying substrate concentrations

  • Data analysis: Non-linear regression analysis using specialized software (e.g., ENZFITTER, SIGMA PLOT)

For the West Nile virus NTPase/helicase, under optimized conditions, the enzyme catalyzes ATP hydrolysis with a kcat value of 133 s⁻¹, demonstrating efficient catalytic activity . For DNA unwinding activity, a lower kcat of 5.5 × 10⁻³ s⁻¹ has been reported, reflecting the complex nature of this secondary function .

How do divalent cations influence NTPase activity?

Divalent cations, particularly Mg²⁺, play a critical role in NTPase catalytic activity:

  • Mg²⁺ typically serves as a cofactor for nucleotide binding and hydrolysis

  • Optimal concentration is generally around 2 mM for most NTPases

  • Alternative divalent cations (Mn²⁺, Ca²⁺) may support activity to varying degrees

The metal ion coordinates with the phosphate groups of the substrate, facilitating proper orientation for nucleophilic attack and subsequent hydrolysis. Experimental protocols must carefully control divalent cation concentrations to ensure reliable and reproducible activity measurements.

How do NTPases contribute to nucleotide pool homeostasis and genome integrity?

NTPases play critical roles in maintaining the balance of nucleotide pools, which directly impacts genomic stability:

  • Nucleotide pool balancing: DCTPP1 contributes to dCTP homeostasis by hydrolyzing excess dCTP to dCMP, preventing imbalances that could lead to mutagenesis

  • Elimination of modified nucleotides: These enzymes hydrolyze potentially mutagenic modified nucleotides, preventing their incorporation into DNA. For example, DCTPP1 efficiently hydrolyzes 5-methyl-dCTP and 5-halogenated nucleotides

  • Protection against nucleoside analogs: DCTPP1-deficient cells show hypersensitivity to nucleoside analogs like 5-iodo-2'-deoxycytidine and 5-methyl-2'-deoxycytidine, demonstrating the enzyme's protective role

Experimental evidence from DCTPP1-deficient cell lines shows they accumulate high levels of dCTP and exhibit increased sensitivity to pyrimidine analogues, confirming the enzyme's role in both nucleotide pool regulation and protection against potentially toxic nucleoside analogs .

What is the role of NTPases in viral replication mechanisms?

Viral NTPases, particularly those with helicase activity, are essential components of viral replication machinery:

  • The West Nile virus NTPase/helicase represents a multifunctional enzyme that couples NTP hydrolysis to nucleic acid unwinding

  • This enzymatic activity provides the energy for unwinding double-stranded nucleic acid intermediates during viral genome replication

  • The dual NTPase/helicase function makes these enzymes potential targets for antiviral drug development

The purification and characterization of the West Nile virus NTPase/helicase has revealed its ability to catalyze both ATP hydrolysis and DNA unwinding, with distinct kinetic parameters for each activity . This bifunctional capacity is critical for successful viral replication and represents a conserved feature among flavivirus NTPases.

How can recombinant NTPases be used as tools in nucleic acid research?

Recombinant NTPases offer numerous applications in molecular biology and biochemical research:

  • Nucleic acid manipulation: NTPases with helicase activity can be employed for controlled unwinding of DNA or RNA structures

  • Nucleotide pool manipulation: Using NTPases to selectively deplete specific nucleotides in experimental systems

  • Structural studies: Purified NTPases serve as models for understanding nucleotide binding and hydrolysis mechanisms

The ability to express and purify these enzymes in recombinant form enables researchers to perform detailed structure-function analyses and develop novel applications in nucleic acid research and biotechnology.

What methodological approaches can distinguish between different NTPase activities?

Distinguishing between various NTPase activities requires specialized methodological approaches:

Substrate profiling:

  • Testing activity against various NTPs (ATP, GTP, CTP, UTP)

  • Examining modified nucleotides (methyl-dCTP, halogenated nucleotides)

  • Determining preference for ribo- versus deoxyribonucleotides

Combined NTPase/helicase assays:

  • ATPase activity measurement using radioactive ATP

  • DNA unwinding assay using labeled oligonucleotide substrates

  • Correlation of NTPase and helicase activities

For complex enzymes like viral NTPase/helicases, activity measurements often involve monitoring both ATP hydrolysis and DNA unwinding functions, each with its distinct kinetic parameters and optimal reaction conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.