Recombinant Nuphar advena ATP synthase subunit a, chloroplastic (atpI)

What is Nuphar advena ATP synthase subunit a, and what is its role in chloroplasts?

Nuphar advena ATP synthase subunit a (atpI) is a critical component of the chloroplastic ATP synthase complex, specifically as part of the membrane-embedded F₀ motor. This protein participates in the proton transport pathway that drives ATP synthesis through rotary catalysis. The F₀ motor harnesses the electrochemical proton gradient generated during photosynthesis, conducting protons through the membrane to drive the rotation of the ATP synthase complex, which ultimately results in ATP production in the F₁ head .

The specific atpI protein from Nuphar advena (common spatterdock) consists of 248 amino acids and functions within the thylakoid membrane of chloroplasts. Its amino acid sequence (MNVLPCSINTLKGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAAIAVRN PQTIPTDGQNFFEYVLEFIRDVSKTQIGEEEYGPWVPFIGTLFLFIFVSNWSGALLPWRI IQLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINVLED FTKPLSLSFRLFGNILADELVVVVLVSLVPLVIPIPVMFLGLFTSGIQALIFATLAAAYI GESMEGHH) contains regions that are essential for proton conduction and integration into the membrane .

How does the structure of atpI relate to its function in ATP synthesis?

The atpI protein forms a critical channel in the F₀ sector of ATP synthase that allows protons to move across the thylakoid membrane. Its structure includes multiple transmembrane domains that anchor it within the membrane, with hydrophilic regions that create the pathway for proton translocation.

The functional significance of this structure is directly related to the chemiosmotic mechanism of ATP synthesis. As protons flow through the channel formed partly by atpI, they cause rotation of the c-ring rotor, which is mechanically coupled to the central stalk (subunit γ) of the F₁ sector. This rotation drives conformational changes in the catalytic sites of F₁, leading to ATP synthesis from ADP and inorganic phosphate .

The relationship between structure and function is particularly evident in the conserved amino acid residues that line the proton pathway, which are essential for maintaining the proper proton conductance and coupling to rotary motion.

What are the optimal storage and handling conditions for recombinant atpI protein?

The recombinant Nuphar advena atpI protein requires specific storage and handling conditions to maintain its structural integrity and functional properties:

• Storage temperature: Store at -20°C to -80°C for long-term preservation. Working aliquots can be maintained at 4°C for up to one week .

• Buffer conditions: The protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

• Aliquoting: Divide the protein into small aliquots upon receipt to avoid repeated freeze-thaw cycles, which can cause protein degradation .

• Reconstitution protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

• Thawing procedure: Thaw frozen aliquots quickly at room temperature and place on ice until use.

Adherence to these conditions is crucial for preserving the functional integrity of the protein for experimental applications.

What expression systems are most effective for producing recombinant atpI?

Based on available data, E. coli has been successfully employed as an expression system for the recombinant Nuphar advena atpI protein . This prokaryotic expression system offers several advantages for membrane protein production:

• Affinity tag options: The addition of an N-terminal His-tag facilitates protein purification while minimizing interference with the protein's function .

• Expression optimization parameters:

  Parameter	Recommended Conditions
  Host strain	E. coli BL21(DE3) or derivatives
  Induction	IPTG (0.1-1.0 mM)
  Temperature	16-25°C after induction
  Culture duration	16-20 hours post-induction
  Media	Enriched media (e.g., 2xYT or TB)

• Membrane integration challenges: As atpI is a membrane protein, specialized approaches may be necessary to enhance proper folding and membrane insertion, such as:

  • Co-expression with chaperones

  • Use of E. coli strains optimized for membrane protein expression

  • Lower induction temperatures to slow protein synthesis

  • Addition of membrane-stabilizing compounds to the growth media

• Extraction considerations: Membrane proteins require detergent-based extraction methods, with mild non-ionic detergents (DDM, LDAO) often being suitable for maintaining native structure.

While E. coli is commonly used, alternative expression systems such as yeast (P. pastoris) or insect cells might offer advantages for more complex structural or functional studies, especially when post-translational modifications or eukaryotic membrane environments are important.

How can recombinant atpI be used to study the redox regulation of chloroplast ATP synthase?

Recombinant atpI provides a valuable tool for investigating the redox-dependent regulation of chloroplast ATP synthase activity, which is a key mechanism for coordinating energy production with cellular demands in plants:

• Investigation of protein-protein interactions: Recombinant atpI can be used in pull-down assays or crosslinking experiments to identify interactions with other ATP synthase subunits involved in redox sensing, particularly in relation to the β-hairpin redox switch in subunit γ that mediates autoinhibition in the dark .

• Reconstitution experiments: Purified recombinant atpI can be incorporated into liposomes along with other ATP synthase components to create a minimal system for studying how proton translocation through the F₀ sector is affected by redox conditions.

• Site-directed mutagenesis approaches:

  • Specific amino acid residues in atpI that may interact with the redox-sensitive regions of other subunits can be mutated

  • The effects of these mutations on ATP synthase activity under varying redox conditions can be measured

  • This approach helps map the communication pathway between the membrane sector and the catalytic domain

• Structural analysis under different redox states: Combining recombinant atpI with other ATP synthase components under oxidizing versus reducing conditions can provide insights into conformational changes that occur during redox regulation.

A methodological workflow might include:

• Expression and purification of wild-type and mutant forms of atpI

• Reconstitution with other ATP synthase components under defined redox conditions

• Measurement of proton translocation efficiency and ATP synthesis rates

• Structural analysis using techniques such as hydrogen-deuterium exchange mass spectrometry to detect conformational changes

What approaches can be used to study the integration of atpI into the thylakoid membrane?

Studying the membrane integration of atpI requires specialized techniques due to the hydrophobic nature of this protein:

• In vitro membrane insertion assays:

  • Purified recombinant atpI can be combined with isolated thylakoid membranes or synthetic liposomes

  • Fluorescence-based techniques can monitor the kinetics and efficiency of insertion

  • Protease protection assays can determine the topology of inserted protein

• Analysis of membrane topology:

  Technique	Application	Advantages
  Cysteine scanning mutagenesis	Mapping accessible residues	Site-specific information
  PEGylation assays	Identifying exposed regions	Does not require antibodies
  Protease accessibility	Determining protein orientation	Relatively straightforward
  FRET analysis	Measuring distances between domains	Provides dynamic information

• Co-translational versus post-translational insertion studies:

  • Cell-free translation systems with added thylakoid membranes can assess co-translational insertion

  • Comparison with post-translational addition of purified protein can reveal preferred insertion pathways

  • Analysis of the role of chloroplast signal recognition particle (cpSRP) in atpI targeting

• Role of auxiliary factors:

  • Identification of chaperones and insertion machinery components that facilitate proper atpI integration

  • Assessment of lipid composition effects on insertion efficiency and protein functionality

  • Investigation of the temporal sequence of ATP synthase assembly in the membrane

These approaches can provide valuable insights into the biogenesis and assembly of functional ATP synthase complexes in chloroplast membranes.

How can researchers assess the functional integrity of recombinant atpI?

Validating the functional integrity of recombinant atpI is essential before using it in complex experiments. Several complementary approaches can be employed:

• Proton conductance measurements:

  • Reconstitution of purified atpI into liposomes containing pH-sensitive fluorescent dyes

  • Measurement of proton flux under applied membrane potential

  • Comparison with known proton conductance rates from native ATP synthase preparations

• Complementation assays:

  • Introduction of recombinant atpI into atpI-deficient systems (bacterial or chloroplast)

  • Assessment of restored ATP synthesis capability

  • Measurement of growth rates under conditions requiring oxidative phosphorylation

• Integration into partial or complete ATP synthase complexes:

  • Co-reconstitution with other purified ATP synthase subunits

  • Analysis of complex formation by native gel electrophoresis

  • Functional testing of the reconstituted complexes for ATP synthesis activity

• Structural validation:

  Method	Information Obtained	Technical Considerations
  Circular dichroism	Secondary structure content	Requires purified protein in detergent
  Limited proteolysis	Domain folding and accessibility	Can verify proper folding
  Thermal stability assays	Protein stability and ligand binding	Monitors unfolding transitions
  Size exclusion chromatography	Oligomeric state and aggregation	Assess monodispersity

• Binding assays with known interaction partners:

  • Surface plasmon resonance or microscale thermophoresis to quantify interactions

  • Co-immunoprecipitation with other ATP synthase subunits

  • Cross-linking followed by mass spectrometry to identify molecular contacts

These methodologies provide a comprehensive assessment of whether the recombinant protein retains native-like properties essential for reliable experimental outcomes.

What spectroscopic techniques are most informative for studying atpI structure and dynamics?

Several spectroscopic techniques offer valuable insights into the structural features and dynamics of atpI:

• FTIR (Fourier Transform Infrared) Spectroscopy:

  • Provides information about secondary structure content in membrane environments

  • Can be used with polarized light to determine helix orientations relative to the membrane

  • Hydrogen-deuterium exchange FTIR can identify water-accessible regions

  • Particularly valuable for membrane proteins that are challenging for other techniques

• Solid-state NMR Spectroscopy:

  • Enables structural studies of membrane-embedded atpI

  • Can provide residue-specific information about protein dynamics

  • Allows analysis in a lipid bilayer environment that mimics native conditions

  • 15N and 13C isotopic labeling enhances spectral resolution and information content

• EPR (Electron Paramagnetic Resonance) Spectroscopy:

  • Site-directed spin labeling combined with EPR provides distance constraints

  • Continuous wave EPR reveals mobility and environmental properties of specific regions

  • Pulsed EPR techniques (DEER/PELDOR) measure longer distances (2-8 nm)

  • Particularly useful for tracking conformational changes during functional cycles

• Fluorescence Spectroscopy:

  • Time-resolved fluorescence can monitor protein dynamics on multiple timescales

  • FRET measurements reveal distances between specifically labeled sites

  • Environmental sensitivity of fluorescent probes indicates local structural properties

  • Single-molecule FRET approaches can detect heterogeneous conformational states

A systematic approach might involve:

• Initial characterization with CD and FTIR to confirm secondary structure content

• Strategic introduction of spectroscopic probes at key functional sites

• Comparative studies under different conditions (pH, membrane potential, etc.)

• Correlation of spectroscopic data with functional measurements to establish structure-function relationships

What strategies can address poor expression yields of recombinant atpI?

Membrane proteins like atpI often present expression challenges. The following strategies can help optimize yields:

• Expression system optimization:

  • Test multiple E. coli strains (BL21, C41/C43, Lemo21) specifically developed for membrane protein expression

  • Consider alternative hosts such as Lactococcus lactis for toxic membrane proteins

  • Explore eukaryotic systems for complex membrane proteins

• Expression construct modifications:

  Modification	Rationale	Implementation
  Codon optimization	Match codon usage to expression host	Gene synthesis with optimized codons
  Fusion partners	Enhance folding and stability	MBP, SUMO, or Mistic fusions
  Signal sequences	Direct to membrane insertion pathways	PelB or DsbA signal sequences
  Truncation constructs	Remove problematic regions	Bioinformatic identification of domains

• Induction and growth conditions:

  • Reduce induction temperature (16-20°C) to slow protein synthesis

  • Use lower inducer concentrations (0.1-0.2 mM IPTG)

  • Employ auto-induction media for gradual protein expression

  • Add specific lipids or membrane-stabilizing compounds (glycerol, betaine)

• Cell lysis and extraction optimization:

  • Screen multiple detergents for efficient extraction (DDM, LDAO, FC-12)

  • Use detergent mixtures that mimic native membrane environments

  • Consider styrene-maleic acid copolymer (SMA) for native nanodiscs

  • Optimize detergent:protein ratios to prevent aggregation

• Enhance protein stability:

  • Add specific lipids during extraction (POPE, POPG, cardiolipin)

  • Include stabilizing additives in buffers (glycerol, arginine, specific ions)

  • Maintain cold temperature throughout purification

  • Consider the addition of specific ligands that bind and stabilize the protein

Implementation of these strategies often requires an iterative approach, systematically testing combinations to identify optimal conditions for the specific protein.

How can researchers troubleshoot issues with atpI reconstitution into liposomes?

Reconstitution of membrane proteins like atpI into liposomes can be challenging. Here are methodological approaches to common problems:

• Poor incorporation efficiency:

  • Optimize detergent types and concentrations during reconstitution

  • Test different lipid compositions to better mimic the native environment

  • Adjust protein:lipid ratios (typically starting with 1:100 to 1:1000 w/w)

  • Consider using a mixture of lipids that includes negatively charged species (POPG, cardiolipin)

  • Implement gradual detergent removal through dialysis or bio-beads

• Incorrect orientation:

  • Use asymmetric reconstitution methods with pH gradients

  • Employ freeze-thaw cycles to promote reorientation

  • Add orientation-specific markers to verify results

  • Conduct protease protection assays to confirm topology

• Loss of function after reconstitution:

  Problem	Potential Causes	Solutions
  Protein denaturation	Harsh detergent exposure	Use milder detergents, shorter exposure
  Aggregation	Inappropriate detergent removal rate	Slow, controlled detergent removal
  Improper folding	Suboptimal lipid environment	Screen various lipid compositions
  Missing components	Incomplete reconstitution	Co-reconstitute with partner proteins

• Liposome instability:

  • Optimize lipid composition for stability (include cholesterol or ergosterol)

  • Control vesicle size through extrusion or sonication

  • Store reconstituted proteoliposomes at appropriate temperatures

  • Add cryoprotectants for freeze-thaw stability

• Heterogeneous preparations:

  • Implement density gradient purification

  • Use size exclusion chromatography to isolate uniform populations

  • Apply dynamic light scattering to monitor size distribution

  • Consider microfluidic approaches for more uniform liposome formation

A systematic approach to optimization involves:

• Initial small-scale screening of multiple conditions

• Validation of protein incorporation by Western blotting or fluorescence

• Functional testing of each preparation

• Refinement of successful conditions to improve reproducibility

How should researchers interpret kinetic data from ATP synthase experiments involving recombinant atpI?

Kinetic analysis of ATP synthase containing recombinant atpI requires careful consideration of several factors:

What computational approaches are valuable for studying atpI structure-function relationships?

Computational methods provide powerful tools for investigating atpI structure, dynamics, and functional mechanisms:

• Homology modeling and ab initio structure prediction:

  • Generation of structural models based on related proteins with known structures

  • Refinement with experimental constraints from spectroscopy or biochemical data

  • Validation through energy minimization and stereochemical analysis

  • AlphaFold2 or RosettaMembrane for membrane protein-specific prediction

• Molecular dynamics simulations:

  • Analysis of protein behavior in explicit membrane environments

  • Investigation of conformational changes during the catalytic cycle

  • Proton translocation pathway identification and characterization

  • Free energy calculations for key transitions or substrate interactions

• Quantum mechanical calculations:

  • Detailed analysis of proton transfer energetics

  • Electronic structure calculations for redox-active sites

  • Hybrid QM/MM approaches for catalytic mechanisms

  • Correlation of calculated parameters with experimental rate data

• Systems biology modeling:

  Approach	Application to atpI Research	Outputs
  Kinetic modeling	Integration into ATP synthase function	Flux predictions
  Network analysis	Positioning in bioenergetic pathways	Regulatory insights
  Multi-scale models	Linking molecular to cellular effects	Physiological impacts
  In silico mutagenesis	Predicting mutation effects	Structure-function maps

• Analysis workflows for membrane protein studies:

  • Integration of lipid-protein interactions into structural models

  • Calculation of membrane insertion energetics for atpI

  • Identification of water molecules in proton translocation pathways

  • Prediction of conformational changes induced by membrane potential

Practical implementation might include:

• Initial structural modeling followed by placement in a realistic membrane environment

• Equilibration and production simulations to observe natural dynamics

• Application of biased simulation techniques to study rare events

• Correlation of computational predictions with experimental observables for validation

These computational approaches complement experimental studies by providing atomic-level details and mechanistic hypotheses that can guide further research.

How might atpI research contribute to understanding ATP synthase evolution across different photosynthetic organisms?

The study of recombinant atpI can provide valuable insights into ATP synthase evolution:

• Comparative analysis across species:

  • Sequence and structural comparisons of atpI from diverse photosynthetic organisms

  • Identification of conserved versus variable regions and their functional significance

  • Correlation between atpI variations and ecological niches or photosynthetic strategies

  • Investigation of co-evolution patterns between atpI and other ATP synthase subunits

• Evolutionary adaptation of proton conductance:

  • Functional characterization of atpI variants from organisms adapted to different environments

  • Analysis of proton pathway modifications in relation to pH optima and energy demands

  • Identification of convergent evolutionary solutions to similar functional challenges

  • Testing the effects of ancestral sequence reconstructions on ATP synthase performance

• Hybrid complexes and complementation studies:

  Experimental Approach	Evolutionary Insight	Methodological Considerations
  Chimeric atpI constructs	Functional domain mapping	Domain boundary identification
  Cross-species complementation	Functional conservation	Compatible expression systems
  Directed evolution experiments	Adaptation trajectories	High-throughput screens
  Ancient sequence reconstruction	Ancestral functions	Phylogenetic accuracy

• Genomic context analysis:

  • Exploration of chloroplast genome organization around the atpI gene

  • Investigation of gene transfer events between chloroplast and nuclear genomes

  • Analysis of regulatory elements affecting atpI expression

  • Correlation between genome structure and ATP synthase evolution

These approaches can address fundamental questions about the evolutionary history of bioenergetic systems and provide insights into the adaptation of energy conversion mechanisms across diverse photosynthetic lineages.

What are the emerging technologies and approaches that could advance atpI research?

Several cutting-edge technologies show promise for advancing the study of atpI and ATP synthase:

• Cryo-electron microscopy advances:

  • Time-resolved cryo-EM to capture different states in the catalytic cycle

  • High-resolution structure determination of the complete ATP synthase complex

  • Visualization of conformational changes induced by proton translocation

  • Structural analysis of atpI in different lipid environments

• Single-molecule techniques:

  • Optical tweezers to measure forces and torques during ATP synthase rotation

  • Fluorescence microscopy to track conformational dynamics in real-time

  • Magnetic tweezers to apply controlled forces to ATP synthase components

  • Correlation of mechanical events with proton translocation and ATP synthesis

• Advanced membrane mimetics:

  • Nanodiscs with defined lipid compositions for controlled reconstitution

  • Droplet interface bilayers for electrical measurements

  • Microfluidic platforms for high-throughput functional screening

  • 3D-printed artificial organelles with incorporated ATP synthase

• Integration with synthetic biology:

  Approach	Research Application	Potential Insights
  Minimal ATP synthase designs	Essential component identification	Engineering principles
  Orthogonal energy systems	Function in non-native contexts	Design constraints
  Biosensor development	Real-time ATP synthesis monitoring	Regulatory mechanisms
  Directed protein evolution	Enhanced or altered functions	Structure-function relationships

• Multi-omics integration:

  • Proteomics to identify post-translational modifications and interaction partners

  • Metabolomics to link ATP synthase activity to metabolic networks

  • Transcriptomics to understand regulation of ATP synthase components

  • Systems biology approaches to model ATP synthase in cellular context

These technologies collectively offer unprecedented opportunities to understand the molecular details of atpI function and its integration into the ATP synthase complex, potentially enabling applications in synthetic biology, bioenergetics, and biomimetic energy conversion systems.