Recombinant Nuphar advena Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Introduction

The development and function of chloroplasts, which are essential organelles for photosynthesis in plant cells, depend on a complex array of biochemical processes within their surrounding envelope membranes . Among the various components of these membranes is the Chloroplast Envelope Membrane protein (CemA), which plays a crucial role in chloroplast function .

General Characteristics of Angiosperm Plastomes

Plastomes, the genomes of plastids such as chloroplasts, exhibit a conserved gene arrangement across most angiosperms . These genomes are typically depicted as circular maps, though they exist in various forms, including linear and branched molecules . Plastomes are gene-dense, containing between 120 and 130 genes within a 120 to 170 kb region .

Gene Content and Function of CemA

The CemA protein is encoded by the cemA gene, which is part of the conserved gene complement found in most angiosperm plastomes . CemA is an integral membrane protein located in the inner envelope membrane of the chloroplast . While functional analyses in higher plants are lacking, studies in Chlamydomonas suggest CemA may participate in proton extrusion and facilitate inorganic carbon uptake into plastids .

CemA within the Chloroplast Envelope

The chloroplast envelope membranes contain a complex biochemical machinery essential for the development of chloroplasts and the integration of their function within a plant cell . Proteomic analysis of these membranes has identified numerous proteins involved in various functions, including ion and metabolite transport, protein import, and lipid metabolism .

Regulation of Photosynthesis

Research indicates that the CHLORAD system, involving proteins like CDC48, regulates photosynthetic performance by targeting chloroplast proteins for ubiquitination and degradation . This system directly controls a range of chloroplast target proteins, including those in the inner envelope membrane, thylakoid, and stroma, highlighting the significance of the chloroplast envelope in photosynthetic regulation .

контрольные точки для развития хлоропластов

Checkpoints appear to regulate the establishment of chloroplast transcription machinery . These checkpoints prevent uncontrolled chloroplast development under adverse conditions and play roles in controlling chloroplast gene transcription .

Core Proteome of Chloroplast Envelope Membranes

Proteomic analyses across different plant species have identified a core set of proteins present in chloroplast envelope membranes . These proteins are predicted to be involved in transport, signaling, and response mechanisms, contributing to the functional understanding of the inner and outer envelope .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Nuphar advena (Common spatterdock) (Nuphar lutea subsp. advena)
Target Names
cemA
Target Protein Sequence
MTKKKALNPLPYLASIVFLPWGISLSFNKSMEPWVTNWWNTSQSETFLNDIQEKNILEGF IKLEELFLLDEMIKEYPETHIQKLRIGIHKETIQLVRMHNQDHIHIILHFSTNITCFAIL SAYSILGNEELIALNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHAWELMIGSFYKD FGFVQNDKIISGLVSTFPVILDTILKYWIFHYLNRVSPSLVVIYHSLNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the function of cemA in Nuphar advena chloroplasts?

The chloroplast envelope membrane protein (cemA) in Nuphar advena indirectly influences CO2 uptake in plastids . As part of the photosynthetic apparatus, cemA plays a crucial role in carbon assimilation pathways. While initially classified under "Function uncertain" in some taxonomic studies, current research positions cemA among proteins essential for photosynthesis, specifically categorized with proteins involved in light-independent photosynthetic processes. The protein is encoded in the chloroplast genome and is conserved across many plant species, indicating its evolutionary importance .

How conserved is the cemA gene across Nymphaeales and related orders?

Comparative chloroplast genomic studies show that cemA is relatively conserved across Nymphaeales, including Nuphar advena. Analysis of chloroplast genomes from Arabidopsis halleri ssp. gemmifera and related species reveals similarity in plastid gene organization . The cemA gene was found intact in most angiosperms studied, though its sequence can vary in GC content across species. In Nuphar, cemA is typically located in the large single-copy (LSC) region of the chloroplast genome with a moderately high GC content compared to other genes in the same region . Evolutionary analyses have not shown cemA to be under significant positive selection pressure in Nuphar, unlike some other plastid genes (such as petB, atpF, psaI, rpl32, rpl16, ycf1, and clpP) that show higher rates of adaptive evolution in other species .

What is the structure of the chloroplast genome where cemA is located in Nuphar advena?

The Nuphar advena chloroplast genome displays the typical quadripartite structure found in most angiosperms. Based on comparative studies with other species, the genome includes:

  • Large Single-Copy (LSC) region: approximately 84,000 bp, containing the cemA gene

  • Small Single-Copy (SSC) region: approximately 17,000 bp

  • A pair of Inverted Repeats (IRa/IRb): approximately 26,000 bp each

What are the optimal expression systems for recombinant Nuphar advena cemA protein?

For recombinant production of cemA from Nuphar advena, researchers should consider several expression systems based on membrane protein complexity:

Bacterial Systems (E. coli):

  • Advantages: Rapid growth, high yields, cost-effective

  • Limitations: Membrane proteins often form inclusion bodies; lack of post-translational modifications

  • Recommendation: Use specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

Yeast Systems (Pichia pastoris):

  • Advantages: Eukaryotic folding machinery, moderate yields, post-translational modifications

  • Recommendation: Particularly useful when protein glycosylation is important

Plant-Based Expression:

  • Advantages: Native-like folding environment, appropriate post-translational modifications

  • Methods: Transient expression in Nicotiana benthamiana or stable transformation in Arabidopsis

To optimize expression, researchers should carefully design constructs with appropriate fusion tags (His, GST, or MBP) to facilitate purification and enhance solubility. Expression conditions must be optimized through small-scale trials before scaling up production .

What are the key considerations for designing primers for cemA amplification from Nuphar advena chloroplast DNA?

When designing primers for cemA amplification from Nuphar advena chloroplast DNA, researchers should consider:

  • Sequence Conservation Analysis:

    • Compare cemA sequences across related species (particularly within Nymphaeales)

    • Target highly conserved regions flanking the gene for primer design

    • Use chloroplast genome data from related species like those in comparative studies

  • Primer Design Parameters:

    • Optimal primer length: 18-25 nucleotides

    • GC content: 40-60%

    • Melting temperature (Tm): 55-65°C with matched Tm between primer pairs

    • Avoid secondary structures and primer-dimers

  • Restriction Site Addition:

    • Include appropriate restriction enzyme sites for downstream cloning

    • Add 3-6 extra nucleotides (5' overhang) before restriction sites for efficient enzyme cutting

    • Ensure restriction sites are absent from the target sequence

  • Codon Optimization:

    • For recombinant expression, consider codon optimization for the chosen expression system

    • Avoid rare codons in the expression host organism

For accurate amplification, use high-fidelity DNA polymerases and optimize PCR conditions through gradient PCR to determine optimal annealing temperatures .

How should sample preparation be optimized for proteomic analysis of recombinant cemA?

Optimizing sample preparation for proteomic analysis of recombinant cemA requires special considerations for membrane proteins:

  • Membrane Protein Extraction:

    • Use detergent-based extraction methods with gentle detergents (DDM, CHAPS, or Triton X-100)

    • Implement sequential extraction to separate cemA from other membrane fractions

    • Consider bicelle or nanodisc formation to maintain native-like environment

  • Protein Digestion Strategy:

    • Employ combination of trypsin with complementary proteases (chymotrypsin or Lys-C)

    • Use acid-labile detergents (RapiGest SF or ProteaseMAX) that are compatible with downstream MS analysis

    • Consider extended digestion times (overnight at 37°C) for complete proteolysis

  • Sample Cleaning and Fractionation:

    • Remove detergents using precipitation (acetone/TCA) or specialized cleanup kits

    • Apply appropriate fractionation methods (SDS-PAGE, SCX, or high-pH RPLC)

    • Consider enrichment strategies for low-abundance peptides

  • Mass Spectrometry Considerations:

    • Use data-independent acquisition (DIA) for comprehensive cemA peptide detection

    • Apply specialized ionization parameters optimized for hydrophobic peptides

    • Consider targeted methods (PRM or SRM) for specific cemA peptides of interest

Sample handling should include rapid freezing methods and protein stabilizers immediately after collection to reduce degradation, with snap-freezing being especially important when handling fresh tissues or cellular lysates4 .

What bioinformatic pipelines are recommended for annotating cemA in newly sequenced Nuphar advena chloroplast genomes?

For annotating cemA in newly sequenced Nuphar advena chloroplast genomes, researchers should implement a multi-step bioinformatic pipeline:

  • Assembly of Chloroplast Genome:

    • Use specialized chloroplast genome assemblers like NOVOPlasty, which has been successfully applied in other plant species

    • Validate assembly quality through coverage analysis and comparison with related species

    • Confirm quadripartite structure typical of angiosperm chloroplast genomes

  • Gene Annotation Pipeline:

    • Primary annotation with GeSeq or DOGMA, specialized for organellar genomes

    • Refine annotations using BLAST comparison against well-annotated chloroplast genomes of related species

    • Verify gene boundaries with RNA-seq data if available

  • cemA-Specific Annotation:

    • Perform targeted alignment with known cemA sequences from related species

    • Verify start/stop codons and reading frame integrity

    • Identify potential RNA editing sites that might modify the protein sequence

  • Validation and Visualization:

    • Manual curation of cemA annotation using Apollo or Artemis

    • Circular genome visualization with OGDRAW or Circos

    • Generate multiple sequence alignments of cemA with MAFFT to confirm conservation patterns

  • Comparative Analysis:

    • Use mVISTA or similar tools to compare sequence identity across chloroplast genomes

    • Calculate nucleotide diversity (π) using DnaSP with sliding window analysis

    • Analyze IR/LSC boundaries as these can be variable regions affecting gene content

This comprehensive approach ensures accurate annotation of cemA while providing context within the complete chloroplast genome .

How can researchers analyze the evolutionary patterns of cemA across different Nymphaeaceae species?

To analyze evolutionary patterns of cemA across Nymphaeaceae species, researchers should employ the following methodological approach:

  • Sequence Collection and Alignment:

    • Obtain cemA sequences from all available Nymphaeaceae species, including Nuphar advena

    • Extract sequences using consistent boundaries from complete chloroplast genomes

    • Perform multiple sequence alignment using MAFFT v7.407 with L-INS-i strategy for highest accuracy

  • Phylogenetic Analysis:

    • Construct phylogenetic trees using maximum likelihood (RAxML or IQ-TREE) and Bayesian inference (MrBayes)

    • Test different nucleotide substitution models to find best fit (using ModelTest-NG)

    • Conduct bootstrap analysis (1000 replicates) and posterior probability calculation

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios using PAML or HyPhy to detect selection signals

    • Implement site-specific models (M1a vs. M2a, M7 vs. M8) to identify positively selected sites

    • Compare selection patterns with other chloroplast genes identified under positive selection in other studies (petB, atpF, psaI, rpl32, rpl16, ycf1, and clpP)

  • Structural Implication Analysis:

    • Map variable sites onto predicted protein structure using homology modeling

    • Correlate amino acid changes with predicted functional domains

    • Analyze whether variable regions coincide with transmembrane domains or functional sites

  • Comparative Rate Analysis:

    • Compare evolutionary rates of cemA with other plastid genes using relative rate tests

    • Calculate nucleotide diversity (π) across the gene using DnaSP v6.12.03

    • Test for molecular clock hypothesis to understand timing of divergence

This approach provides a comprehensive understanding of cemA evolution while identifying potential signatures of adaptation or functional constraints in different Nymphaeaceae lineages .

What mass spectrometry techniques are most suitable for characterizing recombinant cemA protein?

For optimal characterization of recombinant cemA protein, researchers should consider these mass spectrometry approaches:

  • Bottom-up Proteomics (Peptide-centric):

    • LC-MS/MS Analysis: Implement nano-HPLC separation coupled with high-resolution mass spectrometry (Orbitrap or TOF analyzers)

    • Fragmentation Strategies: Apply multiple fragmentation methods:

      • HCD (Higher-energy Collisional Dissociation) for comprehensive coverage

      • ETD (Electron Transfer Dissociation) for post-translational modification analysis

      • UVPD (Ultraviolet Photodissociation) for improved sequence coverage of hydrophobic regions

    • Acquisition Modes: Employ Data Independent Acquisition (DIA) for comprehensive coverage and reproducible quantification4

  • Top-down Proteomics (Protein-centric):

    • Analyze intact cemA protein to preserve structural information

    • Use specialized instrumentation with extended mass range capabilities

    • Apply native MS conditions to maintain protein folding when applicable

  • Targeted Proteomics:

    • Develop PRM (Parallel Reaction Monitoring) or SRM (Selected Reaction Monitoring) assays

    • Target specific peptides unique to cemA for sensitive detection

    • Use isotopically labeled standards for absolute quantification

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply chemical crosslinking to capture protein-protein interactions of cemA

    • Use MS-cleavable crosslinkers for improved identification

    • Implement specialized bioinformatic workflows for crosslink identification

For data analysis, implement peptide spectrum matching using target-decoy approaches to control false discovery rates (recommended <1% FDR at peptide level). This strategy ensures high confidence in cemA identification while minimizing false positives4.

How can researchers optimize protein extraction and purification protocols for cemA from recombinant systems?

Optimizing extraction and purification of recombinant cemA requires specialized approaches for membrane proteins:

Extraction Protocol:

  • Cell Lysis Optimization:

    • For bacterial systems: Combine enzymatic (lysozyme) and mechanical (sonication or French press) methods

    • For yeast/insect cells: Use spheroplasting followed by gentle osmotic lysis

    • For plant systems: Implement buffer systems containing protease inhibitors and reducing agents

  • Membrane Preparation:

    • Separate membrane fractions through differential centrifugation (10,000×g followed by 100,000×g)

    • Wash membrane pellets to remove peripheral proteins (high salt wash with 1M NaCl)

    • Assess cemA localization through Western blotting of different fractions

Solubilization Strategy:

Detergent TypeConcentration RangeAdvantagesLimitations
DDM (n-Dodecyl-β-D-maltoside)0.5-2%Mild, preserves activityExpensive, large micelles
LMNG (Lauryl Maltose Neopentyl Glycol)0.01-0.1%Superior stability, small micellesHigh cost
SMA (Styrene Maleic Acid)2.5%Preserves lipid environmentpH restrictions
Digitonin0.5-1%Very mild, good for complexesExpensive, variable purity

Purification Workflow:

  • Affinity Chromatography:

    • Use appropriate tag system (His, FLAG, or Strep-tag)

    • Optimize binding conditions (detergent concentration, salt, pH)

    • Implement slow flow rates (0.2-0.5 ml/min) to improve binding efficiency

  • Secondary Purification:

    • Size exclusion chromatography to separate protein-detergent complexes

    • Ion exchange chromatography for further purification

    • Assess protein homogeneity through analytical SEC and/or blue native PAGE

  • Quality Control Metrics:

    • Purity assessment: SDS-PAGE and Western blotting

    • Functional integrity: Circular dichroism to assess secondary structure

    • Aggregation analysis: Dynamic light scattering

This systematic approach maximizes the yield of functional cemA protein while maintaining its native-like structure throughout the purification process4 .

What experimental approaches can be used to investigate the role of cemA in CO2 uptake?

To investigate the role of cemA in CO2 uptake, researchers should implement a multi-faceted experimental approach:

  • In vitro Reconstitution Studies:

    • Incorporate purified recombinant cemA into liposomes or nanodiscs

    • Measure CO2/bicarbonate transport using:

      • pH-sensitive fluorescent dyes to track pH changes

      • Isotope labeling (13C) combined with mass spectrometry

      • Stopped-flow spectroscopy for kinetic analysis

  • Mutational Analysis:

    • Generate site-directed mutations in conserved regions of cemA

    • Express wild-type and mutant proteins in parallel

    • Compare transport activities to identify functionally important residues

    • Create truncation variants to map functional domains

  • Complementation Studies:

    • Generate cemA knockout lines in model organisms (Arabidopsis or Chlamydomonas)

    • Complement with Nuphar advena cemA wild-type and mutant variants

    • Assess recovery of photosynthetic efficiency and growth phenotypes

    • Measure CO2 assimilation rates using gas exchange systems

  • Interaction Partner Identification:

    • Perform pull-down assays using tagged cemA protein

    • Identify interaction partners through mass spectrometry

    • Validate interactions using techniques such as BiFC (Bimolecular Fluorescence Complementation)

    • Map interaction interfaces through crosslinking mass spectrometry

  • Physiological Measurements:

    • Compare photosynthetic efficiency in systems with varying cemA expression levels

    • Measure parameters including:

      • Quantum yield of PSII (Fv/Fm)

      • CO2 compensation point

      • Electron transport rate

      • Non-photochemical quenching

This comprehensive approach enables researchers to establish the mechanistic basis of cemA's role in CO2 uptake while identifying key structural elements responsible for its function .

How can researchers study the integration of cemA into the chloroplast membrane system?

Studying cemA integration into chloroplast membranes requires specialized techniques for membrane protein localization and topology:

  • Topology Mapping:

    • Cysteine Scanning Mutagenesis:

      • Introduce single cysteine residues throughout the protein sequence

      • Assess accessibility using membrane-permeable and impermeable thiol-reactive reagents

      • Map transmembrane domains based on protection patterns

    • Protease Protection Assays:

      • Expose isolated chloroplasts or proteoliposomes to proteases

      • Analyze fragment patterns to determine exposed regions

      • Combine with Western blotting using domain-specific antibodies

  • Microscopy-Based Localization:

    • Fluorescence Microscopy:

      • Generate fluorescent protein fusions (GFP, mCherry) with cemA

      • Express in plant systems or isolated chloroplasts

      • Visualize localization within chloroplast membrane systems

    • Immunogold Electron Microscopy:

      • Prepare thin sections of chloroplasts expressing recombinant cemA

      • Label with specific antibodies followed by gold-conjugated secondary antibodies

      • Achieve high-resolution localization within membrane subcompartments

  • Membrane Integration Analysis:

    • Carbonate Extraction:

      • Treat membranes with sodium carbonate (pH 11.5)

      • Separate peripheral (soluble fraction) from integral (membrane fraction) proteins

      • Analyze cemA distribution to confirm integral membrane association

    • Detergent Fractionation:

      • Apply differential solubilization with detergents of varying strengths

      • Determine detergent requirements for cemA extraction

      • Compare with known envelope membrane markers

  • Interaction with Insertion Machinery:

    • Identify components of chloroplast membrane insertion pathways interacting with cemA

    • Use crosslinking approaches to capture transient interactions during membrane insertion

    • Analyze co-purifying factors during early stages of expression

This multi-technique approach provides comprehensive information about cemA's spatial organization within the chloroplast membrane system, its orientation, and the mechanisms governing its integration .

What bioinformatic tools are most useful for predicting structure and function of cemA protein?

For comprehensive structure and function prediction of cemA protein, researchers should employ a strategic combination of bioinformatic tools:

  • Primary Sequence Analysis:

    • Hydropathy Profiling:

      • TMHMM, HMMTOP, or Phobius for transmembrane domain prediction

      • TOPCONS for consensus transmembrane topology

    • Sequence Feature Identification:

      • SignalP for transit peptide prediction

      • InterProScan for functional domain identification

      • COILS for coiled-coil region detection

  • Structural Prediction:

    • Homology Modeling:

      • AlphaFold2 or RoseTTAFold for AI-based structure prediction

      • SWISS-MODEL for template-based modeling if homologs exist

      • ModRefiner for model refinement

    • Validation and Analysis:

      • ProCheck or MolProbity for stereochemical quality assessment

      • PROMALS3D for structure-based multiple sequence alignment

      • ConSurf for mapping evolutionary conservation onto structure

  • Functional Prediction:

    • Binding Site Identification:

      • COACH or 3DLigandSite for ligand binding site prediction

      • electrostatic surface mapping using APBS

      • CASTp for pocket and cavity detection

    • Network Analysis:

      • STRING database for protein-protein interaction prediction

      • InterologFinder for interolog-based interaction prediction

      • KEGG or BioCyc for pathway context analysis

  • Evolutionary Analysis:

    • PAML for selection pressure analysis across species

    • Rate4Site for site-specific evolutionary rates

    • MEME for episodic selection detection

The integration of these tools provides a comprehensive computational framework for cemA characterization, guiding experimental design and interpretation of functional studies .

How should researchers approach quality control and validation in mass spectrometry data analysis for cemA?

Quality control and validation in mass spectrometry data analysis for cemA requires a rigorous framework:

  • Pre-acquisition Quality Control:

    • Instrument performance verification using standard samples

    • LC column performance monitoring through retention time stability

    • Sample complexity assessment through TIC (Total Ion Chromatogram) inspection

  • Peptide Identification Validation:

    • Target-Decoy Approach:

      • Implement FDR control at both peptide and protein levels (<1% recommended)

      • Use decoy database of similar size and composition to target database

      • Apply stringent scoring thresholds for high-confidence identifications4

    • Manual Spectrum Validation for cemA peptides:

      • Verify fragment ion series continuity (b- and y-ions)

      • Confirm presence of diagnostic ions

      • Check mass accuracy (<10 ppm for precursors, <20 ppm for fragments)

  • Quantification Quality Control:

    • Assess technical and biological replicate consistency

    • Apply normalization methods appropriate for the experimental design

    • Evaluate coefficient of variation across replicates (<20% for reliable quantification)

  • Data Visualization and Interpretation:

    • Coverage Maps:

      • Generate peptide coverage maps for cemA sequence

      • Identify regions consistently detected or missing

      • Correlate with predicted structural features (transmembrane domains)

    • Statistical Validation:

      • Apply appropriate statistical tests based on experimental design

      • Implement multiple testing correction (Benjamini-Hochberg procedure)

      • Define significance thresholds (adjusted p-value <0.05)

  • Reporting Standards:

    • Follow minimal reporting guidelines (e.g., MIAPE or Paris Guidelines)

    • Deposit raw data in public repositories (PRIDE, MassIVE)

    • Include quality metrics in supplementary materials

This systematic approach ensures robust identification and quantification of cemA peptides while minimizing false discoveries and enabling reproducibility across different research groups4 .

What are the common challenges in expressing and purifying recombinant cemA protein, and how can they be addressed?

Expressing and purifying recombinant cemA presents several challenges due to its nature as a membrane protein. Below are common issues and solutions:

  • Low Expression Levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Test multiple expression vectors with different promoter strengths

      • Optimize codon usage for the expression host

      • Use specialized strains designed for membrane protein expression

      • Consider fusion partners (MBP, SUMO) to enhance solubility and expression

      • Implement low-temperature induction protocols (16-18°C)

  • Protein Misfolding and Aggregation:

    • Challenge: Incorrect folding leading to inclusion body formation

    • Solutions:

      • Express at lower temperatures with slower induction protocols

      • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

      • Add chemical chaperones to growth media (glycerol, arginine)

      • For refolding: use mild detergents and gradient dialysis methods

      • Consider native-like membrane mimetics (nanodiscs, SMALPs)

  • Inefficient Membrane Extraction:

    • Challenge: Difficult to extract cemA completely from membranes

    • Solutions:

      • Test detergent panel including DDM, LMNG, SMA, and digitonin

      • Optimize detergent:protein ratios through systematic screening

      • Implement sequential extraction strategies

      • Consider detergent mixtures for improved efficiency

  • Protein Instability During Purification:

    • Challenge: Loss of protein during purification steps

    • Solutions:

      • Add stabilizing agents (glycerol 10-20%, specific lipids)

      • Maintain consistent detergent concentration above CMC

      • Minimize purification steps and processing time

      • Include protease inhibitors throughout the procedure

      • Perform purification at 4°C with minimal freeze-thaw cycles

  • Poor Purity or Yield:

    • Challenge: Contaminants or low final concentration

    • Solutions:

      • Implement tandem affinity tags for increased purity

      • Use gradient elution protocols for better separation

      • Optimize salt concentrations to reduce non-specific binding

      • Consider specialized chromatography methods (HIC, SEC)

By systematically addressing these challenges through optimization of expression systems, extraction conditions, and purification protocols, researchers can improve the yield and quality of recombinant cemA protein for functional and structural studies4 .

How can researchers overcome the challenges in identifying cemA peptides in complex proteomic samples?

Identifying cemA peptides in complex proteomic samples presents several technical challenges. Here's a methodological approach to overcome them:

  • Enrichment Strategies for Low-Abundance cemA:

    • Chloroplast Isolation:

      • Implement density gradient purification of intact chloroplasts

      • Further fractionate to enrich envelope membranes

    • Antibody-Based Enrichment:

      • Develop specific antibodies against cemA peptides

      • Apply immunoprecipitation before proteomic analysis

    • Organellar Proteomics:

      • Focus mass spectrometry analysis on chloroplast fractions

      • Apply subfractionation techniques for envelope membrane enrichment

  • Optimization for Hydrophobic Peptide Detection:

    • Enhanced Digestion Protocols:

      • Combine multiple proteases (trypsin + chymotrypsin)

      • Extended digestion times with sequential enzyme addition

      • Use acid-labile detergents to improve digestion efficiency

    • Specialized LC Conditions:

      • Apply longer analytical gradients (120+ minutes)

      • Use stationary phases optimized for hydrophobic peptides

      • Elevated column temperatures (50-60°C) to reduce peptide adsorption

  • Tailored Mass Spectrometry Methods:

    • Acquisition Strategy:

      • Implement targeted methods (PRM/SRM) for known cemA peptides

      • Optimize collision energies for transmembrane peptides

      • Use specialized fragmentation approaches (ETD or UVPD)

    • Data Processing Adjustments:

      • Modify search parameters for membrane proteins

      • Allow for semi-tryptic peptides and missed cleavages

      • Adjust scoring algorithms for hydrophobic peptides

  • Database and Search Strategy Refinements:

    • Custom Database Creation:

      • Include all cemA sequence variants from related species

      • Add potential RNA editing variants that could modify the protein sequence

    • Search Strategy:

      • Implement multi-pass search strategies

      • Consider de novo sequencing for unmatched high-quality spectra

      • Use appropriate FDR calculation methods for targeted analyses

  • Validation Approaches:

    • Synthetic Peptide Standards:

      • Synthesize predicted cemA peptides as reference standards

      • Compare chromatographic behavior and fragmentation patterns

    • Orthogonal Detection Methods:

      • Confirm key findings with Western blotting

      • Apply parallel reaction monitoring for confident identification

This comprehensive strategy enhances the detection sensitivity and confidence for cemA peptides in complex samples, enabling more reliable characterization of this challenging membrane protein4 .

What are the most promising research directions for understanding cemA function in aquatic plants like Nuphar advena?

Several promising research directions could advance understanding of cemA function in Nuphar advena and other aquatic plants:

  • Comparative Functional Genomics:

    • Systematic comparison of cemA structure and function between terrestrial and aquatic plants

    • Investigation of potential aquatic adaptations in cemA sequence and regulation

    • Analysis of cemA expression patterns under different CO2 availabilities in aquatic environments

    • Development of transgenic systems to test functional equivalence of cemA from different ecological niches

  • Environmental Adaptation Studies:

    • Examination of cemA polymorphisms across Nuphar populations from different aquatic habitats

    • Correlation of sequence variations with environmental parameters (water depth, pH, temperature)

    • Experimental verification of adaptive advantages through reciprocal transplantation

    • Investigation of cemA's role in adaptation to fluctuating carbon availability in aquatic settings

  • Systems Biology Integration:

    • Mapping of cemA within the broader carbon concentration mechanism network

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to understand regulatory networks

    • Mathematical modeling of carbon flux with varying cemA function

    • Network analysis to identify key regulatory hubs connecting cemA to photosynthetic efficiency

  • Structural Biology Frontiers:

    • Cryo-EM structure determination of cemA alone and in complex with interaction partners

    • Molecular dynamics simulations of cemA in membrane environments mimicking aquatic plant chloroplasts

    • Structure-guided mutational studies to delineate functional domains

    • Investigation of potential post-translational modifications unique to aquatic environments

  • Applied Research Potential:

    • Exploration of cemA engineering to enhance carbon uptake efficiency in crop plants

    • Investigation of potential applications in carbon sequestration technologies

    • Development of biosensors based on cemA for monitoring aquatic carbon dynamics

    • Analysis of cemA in extremophile aquatic plants for novel biotechnological applications

These research directions promise to illuminate the specialized role of cemA in aquatic plants like Nuphar advena while potentially yielding insights applicable to broader questions in plant adaptation, carbon metabolism, and biotechnology .

How might emerging technologies advance our understanding of recombinant cemA structure and function?

Emerging technologies offer unprecedented opportunities to advance understanding of recombinant cemA structure and function:

  • Advanced Structural Biology Approaches:

    • Cryo-Electron Microscopy:

      • Single-particle analysis for high-resolution structure determination

      • Tomography for visualizing cemA in native membrane contexts

      • Microcrystal electron diffraction for structural details of membrane domains

    • Integrative Structural Biology:

      • Combining NMR, SAXS, and computational modeling for complete structural characterization

      • Mass photometry for analyzing protein complexes in near-native conditions

      • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

  • Single-Molecule Technologies:

    • FRET-Based Approaches:

      • Single-molecule FRET to monitor conformational changes during function

      • FRET sensors to track substrate binding and transport events

      • Time-resolved FRET for capturing transient states

    • Optical Tweezers and Force Spectroscopy:

      • Direct measurement of energetics in cemA-mediated transport processes

      • Analysis of protein-protein and protein-lipid interactions with single-molecule resolution

  • Advanced Imaging Technologies:

    • Super-Resolution Microscopy:

      • STORM or PALM for nanoscale localization within chloroplast membranes

      • Expansion microscopy to visualize protein complexes containing cemA

      • Correlative light and electron microscopy for structural-functional insights

    • Label-Free Imaging:

      • Mass spectrometry imaging for spatial proteomics of cemA distribution

      • Raman microscopy for label-free visualization of structural changes

  • Genome Engineering and High-Throughput Screening:

    • CRISPR-Based Technologies:

      • Base editing for precise modification of cemA sequence

      • CRISPR interference/activation for controlled expression studies

      • Prime editing for introducing specific mutations without double-strand breaks

    • Deep Mutational Scanning:

      • Comprehensive mutational library analysis of cemA

      • Coupling with functional readouts for structure-function mapping

      • Machine learning integration for predictive modeling of functional impacts

  • Computational Advances:

    • AI-Driven Structure Prediction:

      • AlphaFold2 and RoseTTAFold for accurate cemA structure prediction

      • Molecular dynamics simulations in complex membrane environments

      • Quantum mechanics/molecular mechanics for catalytic mechanism studies

    • Network Biology:

      • Integrative multi-omics data analysis through AI approaches

      • Systems-level modeling of cemA's role in carbon concentration mechanisms

      • Digital twin development for in silico testing of cemA modifications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.