Recombinant Nuphar advena NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Nuphar advena (Common spatterdock) (Nuphar lutea subsp. advena)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLMISSVIPILAFIISGVLAPISEGPEKLSSYESGIEPIGDAWIQFRI RYYMFALVFVVFDVETVFLYPWAVSFDVLGVSVFIEALIFVLIPVVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase and what is its function in chloroplasts?

NAD(P)H-quinone oxidoreductase (NQO) is an enzyme that catalyzes the obligatory two-electron reduction of quinones to hydroquinones using either NADH or NADPH as electron donors. This reaction is crucial as it prevents the one-electron reduction of quinones by other enzymes, which would result in oxidative cycling of deleterious radical species . In chloroplasts, the NQO subunit 3 plays a specific role in electron transport chains associated with photosynthesis.

Unlike mammalian NQO1 (also called QR1), which primarily functions in detoxification and protection against carcinogenic effects of quinones and other electrophiles, the chloroplastic NQO in plants like Nuphar advena is integrated into photosynthetic processes. The enzyme helps maintain redox balance within the chloroplast by ensuring efficient electron flow and preventing the formation of reactive oxygen species.

Why is Nuphar advena significant in evolutionary plant biology studies?

Nuphar advena represents a phylogenetically significant model for plant evolutionary studies because it belongs to one of the basal-most lineages of angiosperms (flowering plants) . This position makes it especially valuable for comparative genomic studies seeking to understand the evolution of key plant processes.

As a representative of an early diverging lineage, Nuphar advena retains ancestral features that have been modified in more derived plant lineages. Studying its chloroplast proteins, including NAD(P)H-quinone oxidoreductase, provides insights into the evolutionary trajectory of these enzymes across the plant kingdom. Comparative analyses including representatives from basally diverging lineages are particularly useful for tracing the development of plant biochemical pathways through evolutionary time .

What is known about the general structure of NAD(P)H-quinone oxidoreductases?

While specific structural information for the chloroplastic NAD(P)H-quinone oxidoreductase subunit 3 from Nuphar advena is limited in the available literature, general structural principles can be inferred from related enzymes. Based on human and mouse NAD(P)H-quinone oxidoreductases (QR1), these enzymes typically form homodimers, with each monomer containing 273 residues and one FAD prosthetic group per monomer .

The enzyme contains several key structural elements:

  • A flavin (FAD) prosthetic group that is essential for catalytic activity

  • Specific binding sites for NAD(P)H and quinone substrates

  • Loop structures (particularly loops L5 and L9 in mammalian enzymes) that undergo conformational changes during catalysis

  • An adenosine binding site formed between specific loop structures

  • Residues that make van der Waals contacts with substrate molecules

The catalytic mechanism involves a ping-pong reaction where NAD(P)H first reduces the flavin, then leaves the catalytic site to allow substrate binding at the vacated position .

What methodological approaches are most effective for expressing and purifying recombinant chloroplastic proteins?

Expression and purification of chloroplastic proteins like NAD(P)H-quinone oxidoreductase subunit 3 from Nuphar advena requires special considerations due to their unique properties and subcellular localization. Based on approaches used for similar enzymes, the following methodological strategies are recommended:

Expression strategies:

  • Clone the gene without the chloroplast transit peptide to improve solubility in heterologous systems

  • Use specialized expression vectors containing appropriate tags (His6, GST) for downstream purification

  • Test multiple expression hosts: E. coli (BL21 or Rosetta strains), yeast systems, or insect cells

  • Optimize expression conditions including temperature (often lower temperatures like 18°C improve folding), induction time, and media supplements such as rare codons or chaperones

Purification approaches:

  • Multi-step purification combining:

    • Affinity chromatography using engineered tags

    • Ion exchange chromatography (typically Q-sepharose for negatively charged proteins)

    • Size exclusion chromatography for final polishing and to confirm oligomeric state

Critical considerations:

  • Maintain consistent redox conditions throughout purification to preserve FAD binding

  • Include stabilizing agents (glycerol, reducing agents) in purification buffers

  • Consider incorporation of detergents if membrane association is suspected

The production of crystal-quality protein for structural studies requires particular attention to homogeneity and conformational stability throughout the purification process.

How do conformational changes impact the catalytic cycle of NAD(P)H-quinone oxidoreductases?

Conformational changes play a crucial role in controlling the catalytic cycle of NAD(P)H-quinone oxidoreductases. Based on crystallographic studies of human QR1, the enzyme undergoes significant structural rearrangements during substrate binding and release that are essential for its ping-pong reaction mechanism .

Key conformational changes observed:

  • In the apo state (containing only the FAD prosthetic group), the binding sites for both NAD(P)H and quinone substrates are partially occluded.

  • When NAD(P)H binds, the largest structural changes occur in loops L5 and L9, opening the binding cleft. Specifically:

    • Loop L9 shifts position with maximum displacement of 2.7Å at the α-carbon of Phe-232

    • Tyrosine-128 undergoes significant displacement to participate in stacking interactions with the cofactor

  • After the flavin is reduced and NAD(P)+ departs, the protein undergoes further conformational adjustment to accommodate the quinone substrate at the vacated position.

  • In the absence of bound molecules, Tyr-128 and loop L9 (residues 232-236) close the binding site, partially occupying the space left vacant by the departing molecule .

These conformational changes serve critical functions:

  • They control access to the catalytic site as required by the ping-pong mechanism

  • They protect the flavin and protein groups from exposure to solvent and molecular oxygen when sites are unoccupied

  • They contribute to substrate specificity by forming appropriate binding interactions

The "plasticity of the substrate binding portion" likely explains the enzyme's ability to accommodate diverse quinone substrates of different sizes and chemical properties .

What experimental approaches can distinguish substrate specificity differences between species variants?

Understanding the subtle differences in substrate specificity between species variants of NAD(P)H-quinone oxidoreductase requires a combination of biochemical, structural, and genetic approaches. Based on research with mammalian enzymes, the following experimental strategies are recommended:

Enzyme kinetics analysis:

  • Measure comparative reaction rates with a panel of quinone substrates

  • Determine kinetic parameters (KM, kcat, kcat/KM) to quantify differences in catalytic efficiency

  • The studies in search results demonstrated that human and mouse enzymes reduce menadione (vitamin K3) at rates approximately half that of the rat enzyme

Structural analysis:

  • Obtain high-resolution crystal structures of enzyme variants with and without bound substrates

  • Compare active site architecture and substrate-binding residues

  • The structures reported for human QR1 (1.7Å), mouse QR1 (2.8Å), and human QR1-duroquinone complex (2.5Å) revealed subtle structural differences that explain functional variations

Site-directed mutagenesis:

  • Create chimeric enzymes or point mutations to identify key residues responsible for specificity differences

  • A single amino acid substitution (Tyr-104 to Gln) in rat QR1 made it behave like the human and mouse enzymes, demonstrating the power of this approach

Substrate activation profiling:

  • Test the enzyme's ability to activate various quinolic compounds that require reduction

  • Rat QR1 was found to be more effective in activating chemotherapeutic agents like mitomycin C, EO9, and CB1954 than the human enzyme

This multi-faceted approach allows researchers to thoroughly characterize subtle functional differences and correlate them with specific structural features.

How can structural comparisons between chloroplastic and non-chloroplastic NAD(P)H-quinone oxidoreductases inform functional adaptations?

Structural comparisons between chloroplastic NAD(P)H-quinone oxidoreductases (like that from Nuphar advena) and their non-chloroplastic counterparts (such as human QR1) can reveal important adaptive features related to their different cellular roles. These comparative analyses can focus on several key aspects:

Binding site architecture:

  • Chloroplastic enzymes may have evolved specialized quinone binding sites optimized for plastoquinones rather than the diverse xenobiotic quinones handled by mammalian enzymes

  • Comparing the substrate binding pocket plasticity between plant and animal enzymes can reveal how structural flexibility relates to substrate range

Cofactor preference mechanisms:

  • Structural features determining preference for NADH versus NADPH may differ based on the predominant reducing equivalent available in chloroplasts versus cytosol

  • The adenosine binding cleft between loop L9 and residues 128-130 in L5 identified in mammalian enzymes may be structurally modified in chloroplastic enzymes

Interface with electron transport chains:

  • Chloroplastic enzymes likely have structural adaptations for integration with photosynthetic electron transport components

  • Potential binding surfaces for interaction partners would be evident in comparative structural analysis

Regulatory mechanism differences:

  • Structures may reveal different allosteric regulation sites reflecting the distinct metabolic control needs in chloroplasts versus cytosol

Environmental adaptations:

  • Features that enhance stability under high light conditions or oxidative stress prevalent in chloroplasts

Experimental approaches should include obtaining high-resolution structures of both enzyme types, ideally in multiple functional states, followed by detailed computational analysis of the differences.

What is known about the catalytic mechanism of NAD(P)H-quinone oxidoreductases at the molecular level?

The catalytic mechanism of NAD(P)H-quinone oxidoreductases has been extensively studied through structural and biochemical approaches. These enzymes operate via a distinctive ping-pong bi-bi mechanism that involves direct hydride transfer. Key molecular details include:

Hydride transfer pathway:

  • In the human QR1-duroquinone structure, one ring carbon of the quinone is positioned significantly closer to the flavin N5, suggesting a direct hydride transfer to this specific carbon atom

  • The precise orientation of the quinone substrate relative to the reduced flavin is critical for efficient catalysis

Ping-pong reaction sequence:

  • NAD(P)H binds to the enzyme and transfers a hydride to the N5 position of the FAD prosthetic group

  • NAD(P)+ is released from the active site

  • The quinone substrate binds to the same region previously occupied by the nicotinamide portion of NAD(P)H

  • The reduced flavin transfers a hydride directly to the quinone, forming a hydroquinone

  • The hydroquinone product is released, completing the cycle

Active site control mechanism:

  • Tyrosine-128 and the loop spanning residues 232-236 act as gatekeepers, closing the binding site when empty

  • This conformational control provides "exquisite control of access to the catalytic site that is required by the ping-pong mechanism"

  • The closure of the active site when empty protects the flavin from exposure to solvent and molecular oxygen

The structural data reveals that even small amino acid changes can significantly affect substrate specificity and catalytic rates, explaining the fine specificity differences observed between closely related species variants of the enzyme .

How does phylogenetic positioning of Nuphar advena influence analysis of its chloroplastic proteins?

The phylogenetic positioning of Nuphar advena as a member of one of the basal-most lineages of angiosperms significantly enhances its value for comparative genomic studies of chloroplastic proteins like NAD(P)H-quinone oxidoreductase. This strategic position offers several analytical advantages:

Ancestral feature identification:

  • Proteins from basal lineages like Nuphar advena may retain ancestral features that have been modified or lost in more derived plant groups

  • Comparing chloroplastic proteins from Nuphar advena with those from other plant lineages can help reconstruct the evolutionary trajectory of these proteins

Evolutionary rate calibration:

  • Basal angiosperms provide important calibration points for estimating evolutionary rates of chloroplastic proteins

  • They help establish a timeline for key functional adaptations in chloroplastic electron transport components

Lineage-specific innovation detection:

  • Nuphar advena serves as an outgroup for identifying innovations that emerged later in specific plant lineages

  • Features shared between Nuphar advena and other angiosperms but absent in gymnosperms may represent angiosperm-specific adaptations

Horizontal gene transfer assessment:

  • The comparison of chloroplastic genes across wide phylogenetic spans that include basal representatives allows better detection of potential horizontal gene transfer events

In chloroplast genomic studies, including representatives from basally diverging lineages such as Nuphar advena is considered most useful for performing robust comparative analyses across wide phylogenetic spans .

What bioinformatic tools are most effective for analyzing evolutionary patterns in chloroplastic proteins?

Analyzing evolutionary patterns in chloroplastic proteins like NAD(P)H-quinone oxidoreductase requires specialized bioinformatic approaches that can account for the unique evolutionary dynamics of organellar genomes. Based on comparative chloroplast genomics studies, the following tools and methods are particularly effective:

Sequence analysis tools:

  • MAFFT and MUSCLE for generating high-quality multiple sequence alignments of chloroplastic proteins

  • GBlocks or TrimAl for curating alignments to remove poorly aligned regions

  • MEGA, RAxML, and IQ-TREE for phylogenetic tree construction with appropriate evolutionary models

Evolutionary rate analysis:

  • PAML for detecting signatures of selection (dN/dS ratios) across different lineages

  • HyPhy for site-specific selection analysis to identify functionally important residues

  • RelTime for estimating relative divergence times of chloroplastic genes

Structural evolution analysis:

  • ConSurf for mapping conservation patterns onto protein structures

  • FoldX for assessing the stability impact of historical amino acid substitutions

  • CODEML for detecting coevolving residues that may be functionally linked

Genome-level analysis:

  • Mauve or Sibelia for whole chloroplast genome alignments to examine synteny

  • REPuter for identifying repetitive elements that may influence genomic stability

  • OGDRAW for visualizing gene organization across compared chloroplast genomes

Recommended analytical pipeline:

  • Collect homologous sequences across diverse plant lineages, ensuring inclusion of basal representatives like Nuphar advena

  • Generate and refine multiple sequence alignments

  • Construct robust phylogenetic trees using appropriate models

  • Map sequences onto available structural models

  • Perform comparative analysis of substrate binding sites and catalytic residues

  • Correlate sequence changes with functional divergence

These approaches have been successfully applied in comparative studies including Nuphar advena and other angiosperms to evaluate features such as gene content, nucleotide composition, and structural evolution .

How do nucleotide composition patterns in chloroplast genes compare between basal angiosperms and other plant groups?

Nucleotide composition patterns in chloroplast genes reveal important evolutionary trends and can differ significantly between basal angiosperms like Nuphar advena and other plant groups. Comparative chloroplast genomics studies have examined these patterns across photosynthetic lineages:

GC content variation:

  • Chloroplast genomes generally show distinctive GC content patterns that reflect their evolutionary history

  • Analysis of complete chloroplast genome sequences, including that of Nuphar advena, allows researchers to evaluate features such as nucleotide composition across different evolutionary lineages

  • Basal angiosperms like Nuphar advena often show intermediate patterns between early-diverging plant groups and more derived angiosperms

Codon usage bias:

  • Chloroplastic genes exhibit specific codon usage patterns that can vary between plant lineages

  • These patterns may reflect adaptation to the unique translation machinery of chloroplasts

  • Comparative analysis can reveal whether basal angiosperms like Nuphar advena show ancestral or derived codon usage patterns

Distribution of repetitive elements:

  • Simple sequence repeats (SSRs) and longer dispersed repeats show distinctive distribution patterns in chloroplast genomes

  • Comparative studies including Nuphar advena examine the distribution of these repetitive elements across different plant groups

Nucleotide substitution rate variation:

  • Chloroplast genes evolve at different rates depending on their function and evolutionary constraints

  • Basal angiosperms provide important reference points for calibrating these rates across the plant phylogeny

  • Genes encoding core photosynthetic components like NAD(P)H-quinone oxidoreductase often show different patterns compared to accessory genes

These nucleotide composition patterns provide valuable insights into evolutionary processes and can help explain functional adaptations in chloroplastic proteins across plant lineages.

What are the optimal crystallization conditions for obtaining high-resolution structures of chloroplastic enzymes?

Crystallizing chloroplastic enzymes like NAD(P)H-quinone oxidoreductase presents unique challenges due to their specialized environment and cofactor requirements. Based on successful structural studies of related proteins, the following approaches are recommended:

Pre-crystallization optimization:

  • Ensure protein homogeneity through rigorous size-exclusion chromatography

  • Verify cofactor (FAD) incorporation using spectroscopic methods

  • Remove flexible regions that might hinder crystallization (consider limited proteolysis)

  • Assess protein stability under various buffer conditions using thermal shift assays

Crystallization screening strategy:

  • Employ sparse matrix screening with commercial kits optimized for cofactor-containing proteins

  • Consider specialized screens for chloroplastic/photosynthetic proteins

  • Use sitting drop vapor diffusion for initial screening, followed by hanging drop optimization

  • Implement microseeding techniques to improve crystal quality

Optimization parameters:

  • Protein concentration: Typically 5-15 mg/mL for initial trials

  • Temperature: Compare results at 4°C and 20°C

  • Precipitant concentration: Fine gradients around successful conditions

  • Additives: Screen redox agents, metal ions, and stabilizers

Special considerations for chloroplastic proteins:

  • Include reducing agents to maintain proper redox state of cofactors

  • Consider co-crystallization with substrates to stabilize flexible regions

  • Test lipid additives if membrane association is suspected

Successful example conditions:
Human NAD(P)H:quinone oxidoreductase was successfully crystallized and its structure determined at 1.7-Å resolution . While specific crystallization conditions aren't detailed in the search results, this demonstrates that related enzymes can be successfully crystallized with appropriate techniques.

What strategies can overcome the challenges of expressing plant chloroplastic proteins in heterologous systems?

Expressing chloroplastic proteins from plants like Nuphar advena in heterologous systems presents several challenges that require specialized strategies:

Host selection considerations:

  • E. coli strains optimized for membrane/difficult proteins (C41/C43, SoluBL21)

  • Plant-based expression systems for proteins requiring plant-specific chaperones

  • Insect cell systems for complex eukaryotic proteins with extensive post-translational modifications

Vector design strategies:

  • Remove chloroplast transit peptides to improve solubility

  • Test multiple affinity tags (N-terminal, C-terminal, cleavable)

  • Consider fusion partners that enhance solubility (MBP, SUMO, TrxA)

  • Use codon-optimized synthetic genes matching host codon bias

Expression optimization:

  • Lower temperatures (16-20°C) to slow folding and improve solubility

  • Reduced inducer concentrations for slower, more controlled expression

  • Co-expression with molecular chaperones (GroEL/ES, DnaK/DnaJ)

  • Addition of specific cofactors (FAD) to culture medium

Solubility enhancement techniques:

  • Screen multiple buffer compositions using high-throughput approaches

  • Test various detergents if membrane association is suspected

  • Include stabilizing agents (glycerol, arginine, trehalose)

  • Use osmolytes to promote proper folding

Refolding strategies (if inclusion bodies form):

  • On-column refolding during purification

  • Systematic screening of refolding conditions

  • Pulsed refolding with gradual denaturant removal

Expression yield comparison table:

Expression SystemTypical Yield (mg/L)AdvantagesLimitations
E. coli (standard)5-20Quick, inexpensiveLimited folding machinery
E. coli + chaperones10-30Improved foldingAdditional metabolic burden
Insect cells5-50Better folding, PTMsExpensive, slower
Plant expression1-10Native environmentLower yields, complex

These strategies have been successful for expressing challenging proteins with structures and properties similar to chloroplastic NAD(P)H-quinone oxidoreductase.

What spectroscopic methods are most informative for studying the catalytic mechanism of oxidoreductases?

Spectroscopic methods provide crucial insights into the redox states, conformational changes, and reaction intermediates of oxidoreductases like NAD(P)H-quinone oxidoreductase. The following techniques are particularly valuable for studying these enzymes:

Absorbance spectroscopy:

  • UV-visible spectroscopy tracks changes in the flavin redox state

  • Characteristic absorbance peaks at ~370 nm and ~450 nm for oxidized FAD

  • Decreased absorbance upon reduction of the flavin cofactor

  • Stopped-flow techniques allow monitoring of rapid reaction kinetics

Fluorescence spectroscopy:

  • FAD fluorescence is quenched in the protein environment but changes upon substrate binding

  • FRET-based assays can monitor protein-substrate interactions and conformational changes

  • Tryptophan fluorescence can report on protein conformational changes during catalysis

Circular dichroism (CD) spectroscopy:

Electron paramagnetic resonance (EPR):

  • Can detect semiquinone radical intermediates if formed during catalysis

  • Particularly valuable for distinguishing between one-electron and two-electron transfer mechanisms

  • Spin-labeling specific residues can track conformational changes at key positions

Resonance Raman spectroscopy:

  • Provides detailed information about the vibrational modes of the flavin cofactor

  • Can distinguish different redox and protonation states of the flavin

  • Helps characterize changes in electron density distribution during catalysis

Nuclear magnetic resonance (NMR):

  • For smaller domains, can provide detailed structural information in solution

  • 19F-NMR with strategically introduced fluorine labels can track conformational changes

  • 15N-1H HSQC can monitor substrate binding and induced conformational changes

These methods, especially when combined in an integrated approach, can provide comprehensive insights into the catalytic cycle of NAD(P)H-quinone oxidoreductases, including the "ping-pong" mechanism identified in QR1 enzymes .

How might structural plasticity of NAD(P)H-quinone oxidoreductases be exploited for biotechnological applications?

The structural plasticity of NAD(P)H-quinone oxidoreductases offers unique opportunities for biotechnological applications. Research on these enzymes has revealed that "the plasticity of the substrate binding portion of the site could be involved in allowing the site to accommodate a large variety of quinone substrates" . This natural property can be leveraged in several promising ways:

Bioremediation applications:

  • Engineer enhanced variants to detoxify environmental quinone pollutants

  • Modify substrate specificity to target specific industrial contaminants

  • Develop immobilized enzyme systems for continuous remediation processes

Biocatalysis platforms:

  • Exploit the enzyme's ability to perform stereoselective reductions

  • Engineer variants that can accept non-native substrates for green chemistry applications

  • Develop coupled enzyme systems for complex biotransformations

Biosensor development:

  • Utilize the enzyme's ability to reduce diverse quinones for detecting various analytes

  • Engineer substrate specificity to create sensors for specific environmental toxins

  • Couple with electrochemical detection for sensitive, real-time monitoring systems

Therapeutic enzyme engineering:

  • Design variants with enhanced activity against toxic quinones relevant to human disease

  • Develop enzyme therapies targeting quinone-mediated oxidative stress conditions

  • Create delivery systems for targeted enzyme replacement therapies

Plant stress resistance:

  • Engineer variants with enhanced protective functions against oxidative stress

  • Develop transgenic plants with improved detoxification capabilities

  • Target agricultural applications for resistance to certain herbicides or environmental stressors

The research on QR1 enzymes demonstrates that small changes in protein structure can significantly alter substrate specificity, suggesting that directed evolution approaches could effectively tailor these enzymes for specific biotechnological applications .

What are the implications of comparative studies of NAD(P)H-quinone oxidoreductase for understanding evolutionary adaptations in photosynthetic organisms?

Comparative studies of NAD(P)H-quinone oxidoreductase across different plant lineages, including basal angiosperms like Nuphar advena, provide valuable insights into the evolutionary adaptations of photosynthetic organisms. These studies have several important implications:

Evolutionary trajectory of electron transport mechanisms:

  • By comparing NAD(P)H-quinone oxidoreductase across phylogenetically diverse plants, researchers can trace the development of electron transport mechanisms

  • Basal lineages like Nuphar advena serve as critical reference points for understanding ancestral states of these systems

Adaptation to ecological niches:

  • Variations in the enzyme across plant species may reflect adaptations to different light environments, temperature regimes, or stress conditions

  • Nuphar advena, as an aquatic plant with both submerged and aerial foliage, represents interesting adaptive scenarios for photosynthetic machinery

Coevolution with photosynthetic complexes:

  • Changes in NAD(P)H-quinone oxidoreductase likely coevolved with modifications in other components of the photosynthetic apparatus

  • Comparative studies can reveal patterns of correlated evolution across multiple proteins

Functional innovation in plant lineages:

  • Sequence and structural differences may represent innovations that contributed to the success of different plant groups

  • Understanding these changes can provide insights into key transitions in plant evolution

Selection pressures on chloroplast proteins:

  • Patterns of conservation and variation can identify regions under different selection pressures

  • This information helps distinguish functionally critical regions from those with more flexibility for adaptation

The positioning of Nuphar advena within a basal-most lineage of angiosperms makes it particularly valuable for these comparative studies, as it helps establish the ancestral state of NAD(P)H-quinone oxidoreductase before the diversification of most flowering plants .

How might advances in cryo-electron microscopy change our understanding of chloroplastic enzyme complexes?

Advances in cryo-electron microscopy (cryo-EM) are revolutionizing structural biology and offer transformative potential for understanding chloroplastic enzyme complexes like NAD(P)H-quinone oxidoreductase. These technological developments will impact our understanding in several key ways:

Native complex visualization:

  • Cryo-EM allows visualization of large, native enzyme complexes without crystallization

  • This is particularly valuable for chloroplastic proteins that may exist in large supercomplexes in vivo

  • NAD(P)H-quinone oxidoreductase interactions with other photosynthetic components can be captured in their native state

Conformational ensemble characterization:

  • Unlike crystallography which captures a single state, cryo-EM can reveal multiple conformational states simultaneously

  • This will provide unprecedented insights into the dynamic conformational changes involved in the "ping-pong" mechanism observed in NAD(P)H-quinone oxidoreductases

  • The movement of loops L5 and L9 during substrate binding and release can be directly visualized

Membrane association details:

  • Cryo-EM excels at capturing membrane-associated proteins in near-native lipid environments

  • This will clarify how chloroplastic NAD(P)H-quinone oxidoreductase interacts with thylakoid membranes

  • The influence of lipid composition on enzyme activity and regulation can be assessed

Time-resolved structural changes:

  • Emerging time-resolved cryo-EM approaches allow visualization of reaction intermediates

  • This could capture transient states during the catalytic cycle of the enzyme

  • The direct hydride transfer mechanism suggested by crystallographic studies can be confirmed and elaborated

In situ structural determination:

  • Cellular cryo-electron tomography may eventually allow visualization of the enzyme within intact chloroplasts

  • This would reveal native spatial arrangements and interactions impossible to capture with other methods

These advances will move structural biology beyond the static structures available from crystallography (such as the 1.7-Å resolution structure of human QR1 ) toward dynamic, in situ understanding of enzyme function in the context of the complete photosynthetic machinery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.