Recombinant Nuphar advena NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

What is Nuphar advena NAD(P)H-quinone oxidoreductase subunit 4L and what are its key properties?

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a chloroplastic protein found in Nuphar advena (Common spatterdock), a flowering aquatic plant also known as Nuphar lutea subsp. advena. This protein is part of the NAD(P)H dehydrogenase complex in the chloroplast, which catalyzes the transfer of electrons from NAD(P)H to quinones. The protein consists of 101 amino acids with the sequence MmLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNMNLVTFSDLFDSRQLKGD VFSIFVIAIAAAEAAIGPAIVSSIYRNRKSTRINQSNLLNK. It has an EC number of 1.6.5.-, indicating its classification as an oxidoreductase acting on NADH or NADPH with various acceptors . The protein is characterized by its membrane-spanning domains and plays a crucial role in cyclic electron flow around photosystem I in chloroplasts, contributing to ATP synthesis without net NADPH production.

What are the optimal storage conditions for the recombinant protein?

The recombinant Nuphar advena NAD(P)H-quinone oxidoreductase subunit 4L should be stored at -20°C for regular use, or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which helps maintain stability during freeze-thaw cycles . It is strongly recommended to avoid repeated freezing and thawing as this can lead to protein denaturation and loss of enzymatic activity. For working solutions, aliquots can be stored at 4°C for up to one week . When handling the protein, it is advisable to briefly centrifuge the tubes before opening to ensure that material adhering to the cap or sides of the tube is collected, preventing potential sample loss.

How does this protein differ from other NAD(P)H-quinone oxidoreductase subunits?

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is distinct from other subunits in the same complex, such as the NdhH subunit. While NdhH is a larger protein (approximately 45-49 kDa) involved in the NAD(P)H binding domain of the complex, the subunit 4L is smaller and serves as a membrane-embedded component . These different subunits work together in the chloroplast NDH complex, which resembles mitochondrial Complex I but has evolved specifically for photosynthetic function. The subunit 4L is conserved across various plant species, indicating its evolutionary importance. Unlike some other subunits that may have catalytic functions, subunit 4L likely plays a structural role in the assembly and stability of the complex, facilitating electron transfer through the membrane domain .

What are the recommended protocols for working with the recombinant protein in vitro?

When working with recombinant Nuphar advena NAD(P)H-quinone oxidoreductase subunit 4L in vitro, researchers should first reconstitute the lyophilized protein in an appropriate buffer system. For enzymatic assays, a standard protocol involves measuring electron transfer from NADPH or NADH to quinone acceptors such as ubiquinone or plastoquinone in a spectrophotometric assay. The reaction should be conducted in a buffer containing 50 mM Tris-HCl (pH 7.5), 100 mM NaCl, and 0.1% detergent (such as n-dodecyl β-D-maltoside) to maintain protein solubility . Activity can be monitored by following the decrease in absorbance at 340 nm, corresponding to NAD(P)H oxidation. For structural studies, the protein should be maintained in a stabilizing buffer with appropriate detergent concentrations to prevent aggregation while preserving native conformation.

How can researchers effectively detect and quantify the protein in experimental samples?

Detection and quantification of NAD(P)H-quinone oxidoreductase subunit 4L can be achieved through several complementary approaches. Western blotting using specific antibodies represents a reliable method, with commercially available antibodies showing cross-reactivity across multiple plant species . For this approach, proteins should be extracted from plant tissues using a buffer containing 8M urea, 100 mM Tris-HCl (pH 7.5), 1 mM EDTA, and 2% SDS, followed by TCA precipitation and acetone washing to remove interfering compounds . Western blots should be performed using a 1:5000 antibody dilution with appropriate secondary antibodies. Mass spectrometry-based approaches can provide absolute quantification using labeled reference peptides. For activity-based detection, enzymatic assays measuring NADPH oxidation in the presence of quinone substrates can indirectly quantify functional protein levels in complex samples.

What controls should be included in experiments using this protein?

Rigorous experimental design with appropriate controls is essential when working with NAD(P)H-quinone oxidoreductase subunit 4L. Positive controls should include known functional homologs from well-characterized species such as Arabidopsis thaliana, while negative controls should incorporate heat-inactivated enzyme or samples from species known to lack reactivity, such as Pisum sativum or Phaseolus vulgaris . For enzymatic assays, substrate-free controls and enzyme-free controls are necessary to account for non-enzymatic reactions and background absorbance changes. When performing immunological detection, blocking peptide controls can validate antibody specificity. Additionally, researchers should include time-zero measurements and standard curves with purified protein at known concentrations for accurate quantification. These controls collectively enable reliable data interpretation and troubleshooting of experimental anomalies.

How does the structure of NAD(P)H-quinone oxidoreductase subunit 4L relate to its function in chloroplasts?

The structure-function relationship of NAD(P)H-quinone oxidoreductase subunit 4L reveals important insights into its role in chloroplastic electron transport. The protein contains hydrophobic transmembrane domains, as evidenced by its amino acid sequence (MmLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNMNLVTFSDLFDSRQLKGD VFSIFVIAIAAAEAAIGPAIVSSIYRNRKSTRINQSNLLNK), which enable it to anchor within the thylakoid membrane . These membrane-spanning regions facilitate electron transfer across the membrane barrier, allowing electrons from stromal NAD(P)H to reduce quinones within the membrane. The protein's structure includes conserved residues that form part of the quinone-binding pocket, positioning the substrate optimally for electron acceptance. Additionally, structural motifs for interaction with other NDH complex subunits ensure proper assembly of the multiprotein complex. Understanding these structural elements provides insights into electron flow directionality and the proton-pumping mechanism that contributes to the formation of the proton gradient used for ATP synthesis.

What are the implications of NAD(P)H-quinone oxidoreductase subunit 4L in stress response mechanisms in plants?

NAD(P)H-quinone oxidoreductase subunit 4L plays a significant role in plant stress responses, particularly under conditions that affect photosynthetic efficiency. The NDH complex, of which this subunit is a part, becomes especially important during environmental challenges such as drought, high light intensity, and temperature fluctuations. Under these stressors, the cyclic electron flow around photosystem I, facilitated by the NDH complex, helps maintain the proton gradient across the thylakoid membrane when linear electron flow is compromised . This mechanism protects the photosynthetic apparatus from photo-oxidative damage by dissipating excess excitation energy. Research indicates that plants with impaired NDH complex function show increased sensitivity to abiotic stresses, suggesting that NAD(P)H-quinone oxidoreductase subunit 4L and its associated complex serve as an important adaptation for plant survival under fluctuating environmental conditions.

What are common challenges in purifying and maintaining the stability of the recombinant protein?

Purification and stability maintenance of recombinant NAD(P)H-quinone oxidoreductase subunit 4L present several challenges due to its membrane-associated nature. The hydrophobic domains tend to cause protein aggregation during extraction and purification, which can be mitigated by using appropriate detergents such as n-dodecyl β-D-maltoside or digitonin at critical micelle concentrations . Another challenge is maintaining the native conformation during purification, as the protein may not fold properly when expressed in heterologous systems. Researchers frequently encounter issues with low yield and activity loss during purification steps. To address these challenges, optimized protocols include purification under mild conditions, use of stabilizing agents such as glycerol (typically 50%), and storage at -20°C or -80°C to prevent degradation . Additionally, preparing small aliquots for single use can avoid protein damage from repeated freeze-thaw cycles, and adding reducing agents can prevent oxidation of critical cysteine residues.

How can researchers distinguish between activity of NAD(P)H-quinone oxidoreductase subunit 4L and other similar enzymes?

Distinguishing the specific activity of NAD(P)H-quinone oxidoreductase subunit 4L from other similar enzymes requires careful experimental design. Since this protein is part of a larger complex, isolating its specific contribution presents a significant challenge. Researchers can employ several strategies, including the use of specific inhibitors that differentially affect various oxidoreductases. For example, rotenone inhibits mitochondrial Complex I but has less effect on the chloroplastic NDH complex. Biochemical assays can be performed with different electron donors and acceptors to exploit the substrate preferences of various oxidoreductases . Additionally, genetic approaches using knockout or knockdown lines specifically targeting the ndhE gene can help attribute observed activities to this particular subunit. Immunoprecipitation with subunit-specific antibodies followed by activity assays can isolate the complex containing NAD(P)H-quinone oxidoreductase subunit 4L from other similar enzymes. Mass spectrometry-based proteomics can also confirm the presence and abundance of this specific subunit in active fractions.

What analytical techniques are most effective for studying protein-protein interactions involving this subunit?

Multiple analytical techniques can effectively characterize protein-protein interactions involving NAD(P)H-quinone oxidoreductase subunit 4L. Co-immunoprecipitation using antibodies against this subunit can pull down interaction partners, which can then be identified through mass spectrometry . Blue native polyacrylamide gel electrophoresis (BN-PAGE) is particularly valuable for studying membrane protein complexes, allowing visualization of the intact NDH complex and subcomplexes under non-denaturing conditions. Crosslinking mass spectrometry can provide detailed information about the spatial arrangement of interacting proteins by capturing transient interactions through chemical crosslinking followed by mass spectrometric analysis. For in vivo studies, split-fluorescent protein complementation assays or FRET (Förster resonance energy transfer) can verify interactions in the native cellular environment. Computational approaches, including molecular docking and molecular dynamics simulations, can predict structural interfaces between this subunit and its interaction partners. These techniques collectively provide a comprehensive understanding of how NAD(P)H-quinone oxidoreductase subunit 4L integrates within the larger NDH complex.

How can this protein be utilized in photosynthesis enhancement research?

NAD(P)H-quinone oxidoreductase subunit 4L offers significant potential for photosynthesis enhancement research due to its role in cyclic electron flow around photosystem I. By manipulating the expression or activity of this protein, researchers can potentially modify the balance between linear and cyclic electron transport in chloroplasts, optimizing energy production under various environmental conditions . Overexpression strategies could enhance the plant's capacity to maintain ATP synthesis under stress conditions, while site-directed mutagenesis of specific residues might alter the efficiency of electron transfer. The protein could serve as a target for rational design approaches to engineer plants with improved photosynthetic efficiency, particularly under fluctuating light conditions where cyclic electron flow becomes crucial. Additionally, comparative studies of this subunit across species with different photosynthetic efficiencies may identify natural variants with enhanced properties that could be transferred to crop species through biotechnological approaches.

What are emerging techniques for studying the dynamics of this protein in living plant systems?

Emerging techniques for studying NAD(P)H-quinone oxidoreductase subunit 4L dynamics in living plants are advancing our understanding of its function in real-time. Advanced imaging approaches, including confocal microscopy with fluorescently tagged versions of the protein, enable visualization of its localization and movement within chloroplasts. Super-resolution microscopy techniques can overcome the diffraction limit to provide nanoscale details of its organization within thylakoid membranes . Time-resolved spectroscopy allows for monitoring electron transfer events on microsecond to millisecond timescales, capturing the kinetics of reactions involving this protein. CRISPR-Cas9 gene editing enables precise modification of the endogenous gene to create reporter fusions or conditional alleles for functional studies. Optogenetic approaches are being developed to control protein activity using light, allowing for temporal manipulation of electron transport processes. These cutting-edge techniques collectively provide unprecedented insights into the dynamic behavior of NAD(P)H-quinone oxidoreductase subunit 4L within its native cellular context.