Recombinant Nuphar advena NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Nuphar advena (Common spatterdock) (Nuphar lutea subsp. advena)
Target Names
ndhG
Target Protein Sequence
MDLPAPIHDILLVSLGSGLIVGGLGVVLLTNPIYSAFSSGLVLVCISLFYIPSNSYFVAA AQLLIYVGAINVLILFAVMFMNGSEYYNSFHFWTIGDGFTSVVCTSIFFSLIATIPNTSW YGIIWTTRSNQIIEQDLTSNVQQIGIHLSTDFYLPFELISIILLVSLVGAIAMARRE
Uniprot No.

Target Background

Function
NDH (NAD(P)H dehydrogenase) facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the enzyme's immediate electron acceptor. It couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P)H-quinone oxidoreductase in chloroplasts?

NAD(P)H-quinone oxidoreductase in chloroplasts functions as part of the NDH complex, which catalyzes the transfer of electrons from NADH or NADPH to quinones. This enzyme plays an essential role in cyclic electron flow around photosystem I, chlororespiration, and photoprotection. The chloroplastic NAD(P)H-quinone oxidoreductase complex is structurally and functionally similar to complex I of the mitochondrial respiratory chain, but has evolved specifically for the chloroplast environment. Unlike the cytosolic NQO1 enzyme that primarily functions in detoxification pathways through 2-electron reduction of quinones to less reactive hydroquinones, the chloroplastic NDH complex is integrated into photosynthetic electron transport . This fundamental difference reflects the specialized role of the chloroplastic enzyme in energy metabolism rather than solely in antioxidant defense.

How does the Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6 differ from other plant species?

The Nuphar advena (yellow water lily) NAD(P)H-quinone oxidoreductase subunit 6 represents an interesting evolutionary case since Nuphar belongs to one of the basal-most lineages of angiosperms (Nymphaeaceae). Comparative analysis with other plant species reveals several distinctive features in the protein sequence, reflecting its evolutionary position. While maintaining the core catalytic domains, the Nuphar variant shows specific amino acid substitutions that may contribute to its adaptation to aquatic environments. Similar to other chloroplastic NDH subunits like NdhB and NdhH, the subunit 6 protein is encoded by the chloroplast genome in Nuphar advena, as revealed through complete plastid genome sequencing . This conservation of chloroplast-encoded NDH subunits across diverse plant lineages highlights the fundamental importance of this complex in photosynthetic function, despite variations in specific amino acid sequences that may reflect environmental adaptations.

What is the predicted structure and key domains of this protein?

The NAD(P)H-quinone oxidoreductase subunit 6 from Nuphar advena is predicted to contain several transmembrane domains that anchor it within the thylakoid membrane of chloroplasts. Structural prediction models suggest the protein adopts a conformation with both membrane-spanning regions and hydrophilic domains extending into the stroma. Key functional domains include NADH-binding motifs, iron-sulfur cluster coordination sites, and quinone interaction regions. The protein likely contains conserved cysteine residues involved in redox sensing and electron transfer. Similar to other NDH subunits such as NdhB (subunit 2) and NdhH, which have molecular weights of approximately 35 kDa and 45-49 kDa respectively, subunit 6 is expected to have a characteristic molecular weight that can be verified through western blot analysis . The protein's structure reflects its specialized function in electron transport within the chloroplast environment.

What expression systems are most effective for producing recombinant Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6?

Comparative Expression System Efficiency

Expression SystemYieldProper FoldingPost-translational ModificationsRecommended Application
E. coli (standard)MediumVariableMinimalBasic structural studies
E. coli (membrane-optimized)Medium-highImprovedMinimalFunctional analysis requiring large quantities
Yeast (P. pastoris)MediumGoodModerateStructural and limited functional studies
Insect cellsMedium-highVery goodGoodDetailed functional studies
Plant transient expressionLow-mediumExcellentExcellentNative protein studies, protein-protein interactions
Chloroplast transformationLowExcellentExcellentIn vivo studies, physiological relevance

For research requiring native-like protein for functional studies, transient expression in Nicotiana benthamiana using chloroplast-targeting transit peptides has proven effective, though yields are typically lower than bacterial systems. When expressing in bacterial systems, optimizing codons for E. coli usage and lowering the induction temperature to 16-18°C significantly improves proper folding of this membrane-associated protein .

What are the critical factors for successful purification of the recombinant protein?

Successful purification of recombinant Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6 requires careful consideration of multiple factors due to its membrane-associated nature. The critical factors include:

  • Detergent selection: Mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin at 0.5-1% concentration effectively solubilize the protein while preserving its structural integrity. Harsher detergents like SDS should be avoided as they denature the protein.

  • Buffer composition: Purification buffers containing 20-50 mM phosphate or Tris (pH 7.0-8.0), 100-300 mM NaCl, 10% glycerol, and 5 mM β-mercaptoethanol help maintain protein stability. The addition of 5-10 μM FAD in buffers is essential as NAD(P)H-quinone oxidoreductases contain FAD as a cofactor.

  • Affinity tag selection: For initial purification, histidine tags (6xHis) positioned at the C-terminus generally provide better results than N-terminal tags, which may interfere with proper folding. Alternative tags like Strep-II tag can be used for applications where high purity is required.

  • Reducing agent presence: Maintaining a reducing environment with 1-5 mM DTT or 5-10 mM β-mercaptoethanol throughout purification prevents oxidation of cysteine residues that are critical for electron transfer function.

Implementing a two-step purification strategy combining affinity chromatography followed by size exclusion chromatography typically yields protein with >90% purity. Throughout the purification process, keeping samples at 4°C and adding protease inhibitors (e.g., PMSF, leupeptin) is essential to prevent degradation of this relatively unstable membrane protein .

How can you verify the proper folding and functionality of purified recombinant NAD(P)H-quinone oxidoreductase?

Verifying proper folding and functionality of purified recombinant Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6 requires a multi-faceted approach:

  • Spectroscopic analysis: Properly folded protein exhibits characteristic absorbance peaks at 375 nm and 450 nm due to the FAD cofactor. The ratio between these peaks and the protein peak at 280 nm provides important information about cofactor incorporation.

  • Enzymatic activity assay: Functionality can be assessed through quinone reduction assays measuring the oxidation of NAD(P)H spectrophotometrically. This assay monitors the decrease in absorbance at 340 nm as NAD(P)H is oxidized in the presence of various quinone substrates such as decylubiquinone or menadione. The specific activity should be compared with that of the native protein or similar proteins from other species .

  • Circular dichroism (CD) spectroscopy: This technique provides information about secondary structure elements, helping determine if the recombinant protein has folded correctly. The CD spectrum of properly folded NAD(P)H-quinone oxidoreductase typically shows characteristic features of mixed α-helical and β-sheet content.

  • Thermal shift assay: This assay measures the melting temperature (Tm) of the protein, indicating its stability. A well-folded protein will display a clear, cooperative unfolding transition. Adding NAD(P)H or quinone substrates should increase thermal stability if binding sites are properly formed.

  • Limited proteolysis: Correctly folded proteins display characteristic resistance patterns to proteolytic digestion. Comparing the digestion pattern of the recombinant protein with that of the native enzyme can confirm structural integrity.

It's important to note that full functionality may require association with other NDH complex subunits, so reconstitution experiments with additional subunits might be necessary for comprehensive functional assessment .

What experimental approaches best characterize the electron transport activities of this enzyme?

Characterizing the electron transport activities of recombinant Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6 requires sophisticated methodologies that address both isolated protein function and its context within the larger NDH complex:

  • Spectrophotometric assays: The standard approach involves monitoring NAD(P)H oxidation at 340 nm in the presence of electron acceptors. For comprehensive characterization, researchers should determine enzyme kinetics (Km, Vmax, kcat) using various substrates including both NADH and NADPH to assess cofactor preference. Unlike cytosolic NQO1 that can utilize both cofactors with preference for NADH, chloroplastic NAD(P)H-quinone oxidoreductase may show distinct preference patterns .

  • Oxygen consumption measurements: Using oxygen electrodes to measure oxygen consumption rates in the presence of NAD(P)H and various quinones provides valuable insights into the enzyme's role in redox cycling. This approach helps distinguish between the 2-electron reduction pathway (predominant in NQO1) versus potential 1-electron reduction that would generate reactive oxygen species.

  • Electron paramagnetic resonance (EPR) spectroscopy: This technique allows detection of semiquinone intermediates and iron-sulfur clusters during electron transfer. Time-resolved EPR provides valuable insights into the electron transfer kinetics and pathway within the protein.

  • Reconstitution into liposomes: Incorporating the purified protein into liposomes allows measurement of electron transport across membranes, more closely mimicking the native chloroplast environment. This system can be coupled with membrane-impermeable electron acceptors to determine directionality of electron transport.

  • Mutagenesis studies: Systematic site-directed mutagenesis of conserved residues helps identify amino acids critical for electron transfer, substrate binding, and protein-protein interactions within the NDH complex.

For comprehensive characterization, these approaches should be combined with structural studies (X-ray crystallography or cryo-EM) to correlate function with structure, particularly focusing on how subunit 6 interacts with other components of the NDH complex .

How does this protein interact with other components of the chloroplastic electron transport chain?

Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6 functions as part of the multi-subunit NDH complex in chloroplasts, interacting with numerous protein partners in a highly coordinated manner:

  • Interactions within the NDH complex: Subunit 6 establishes critical contacts with other NDH subunits including NdhB (subunit 2) and NdhH, forming part of the membrane domain of the complex. These interactions can be studied using co-immunoprecipitation with antibodies against known subunits like those described for NdhB and NdhH . Cross-linking experiments followed by mass spectrometry analysis reveal specific interaction sites between subunits.

  • Association with the photosynthetic electron transport chain: The NDH complex interacts with photosystem I (PSI) to facilitate cyclic electron flow. This interaction can be characterized through blue native PAGE combined with western blotting, which preserves native protein-protein interactions. Studies have shown that disruption of specific NDH subunits can destabilize these supercomplexes.

  • Thylakoid membrane localization: Fractionation studies of chloroplast membranes reveal that the NDH complex, including subunit 6, localizes primarily to the stromal lamellae rather than grana stacks. This spatial organization facilitates interaction with other electron transport components and can be visualized using immunogold electron microscopy.

  • Dynamic associations during stress responses: Under various stress conditions, particularly high light or drought stress, the interactions between the NDH complex and other photosynthetic components are modulated. These dynamic changes can be monitored using FRET-based approaches with fluorescently labeled proteins.

The specific contribution of subunit 6 to these interactions appears to involve both structural roles in complex assembly and functional roles in electron transfer pathways. Mutation or deletion studies of this subunit in model plant systems demonstrate destabilization of the entire NDH complex, suggesting its importance in maintaining structural integrity of the complex .

What are the advanced methodologies for studying the redox properties of this enzyme?

Advanced methodologies for studying the redox properties of Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6 span multiple sophisticated techniques:

  • Protein film voltammetry (PFV): This electrochemical technique involves immobilizing the purified protein on an electrode surface and measuring electron transfer under controlled potential. PFV provides direct measurement of redox potentials of various electron transfer centers within the protein and can reveal the thermodynamics and kinetics of electron transfer events. For membrane proteins like subunit 6, modified electrodes with hydrophobic surfaces improve protein orientation and stability.

  • Redox titrations with spectroscopic monitoring: This approach involves stepwise reduction or oxidation of the protein while monitoring spectral changes using UV-visible, fluorescence, or EPR spectroscopy. This reveals the redox potentials of different cofactors and their interactions. For NAD(P)H-quinone oxidoreductase, monitoring flavin and iron-sulfur cluster signals is particularly informative.

  • Stopped-flow spectroscopy: This rapid kinetics technique measures the rates of electron transfer between the enzyme and its substrates on millisecond to second timescales. By rapidly mixing the enzyme with substrates and following spectral changes, researchers can identify transient intermediates and determine rate-limiting steps in the catalytic cycle.

  • Single-molecule fluorescence resonance energy transfer (smFRET): This technique tracks conformational changes associated with electron transfer at the single-molecule level. By labeling specific domains of the protein with fluorescent dyes, researchers can observe how electron transfer events correlate with structural rearrangements.

  • Quantum mechanics/molecular mechanics (QM/MM) computational methods: These advanced computational approaches model electron transfer pathways through the protein structure, providing insights into the energetics and mechanisms that may be difficult to observe experimentally.

When applying these methodologies to Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6, researchers must consider its membrane-associated nature and potential requirements for lipid environments or other subunits to maintain native redox properties. Comparative studies with homologous proteins from other species can provide valuable evolutionary context for interpreting results .

How does Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6 compare structurally with homologs from other plant species?

Comparative structural analysis of Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6 with homologs from other plant species reveals both conserved features and unique adaptations:

This comparative approach not only illuminates evolutionary relationships but also helps identify structural elements that might be targeted for engineering enhanced NDH activity in crop plants, particularly for improving stress tolerance .

What insights does comparative genomics provide about the evolution of this protein in aquatic plants?

Comparative genomics analysis of NAD(P)H-quinone oxidoreductase subunit 6 across plant lineages provides significant insights into its evolution in aquatic plants like Nuphar advena:

These genomic insights help reconstruct the evolutionary history of photosynthetic adaptations in aquatic environments and provide context for understanding how electron transport chains have been modified during plant diversification and habitat adaptation .

How can phylogenetic analysis of this protein inform our understanding of plant adaptation to different photosynthetic environments?

Phylogenetic analysis of NAD(P)H-quinone oxidoreductase subunit 6 across diverse plant lineages provides valuable insights into plant adaptation to varying photosynthetic environments:

  • Correlation with photosynthetic mechanism: Phylogenetic trees constructed from subunit 6 sequences cluster species not only by taxonomic relationships but also by photosynthetic mechanisms (C3, C4, CAM). Statistical analyses of character mapping on these trees reveal that specific amino acid substitutions correlate with photosynthetic pathway transitions. For aquatic plants like Nuphar advena, which utilize C3 photosynthesis under challenging aquatic light conditions, particular residues appear to have been selected to optimize electron transport under reduced light intensity .

  • Environmental adaptation signatures: Bayesian phylogenetic methods can identify branches with accelerated evolutionary rates, often corresponding to major habitat transitions. For Nuphar and other aquatic plants, these accelerated branches frequently show adaptive substitutions in regions interfacing with other NDH subunits, suggesting reorganization of complex interactions during adaptation to aquatic environments.

  • Ancestral sequence reconstruction: By reconstructing ancestral sequences at key nodes in the plant phylogeny, researchers can identify the specific sequence changes that occurred during transitions to aquatic habitats. These reconstructions suggest that adaptation to aquatic photosynthesis involved subtle changes in multiple residues rather than dramatic structural reorganization.

  • Correlation with photoprotection capabilities: Statistical association studies between sequence variations and physiological measurements of photoprotection capacity across species reveal that specific residues in subunit 6 strongly correlate with a plant's ability to dissipate excess light energy. For Nuphar, which must cope with rapidly fluctuating light conditions in aquatic environments, these photoprotective adaptations appear particularly refined .

  • Co-evolutionary analysis with interacting proteins: Tools that detect co-evolutionary patterns between interacting proteins reveal how subunit 6 has co-evolved with other NDH complex components across plant lineages. These patterns differ significantly between terrestrial and aquatic lineages, suggesting different selective pressures on protein-protein interactions in these environments.

This phylogenetic perspective not only illuminates the evolutionary history of photosynthetic adaptations but also identifies specific molecular mechanisms that could be targeted for engineering improved photosynthetic efficiency in crops, particularly for stressful or variable light environments .

What are the common challenges in expressing recombinant Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6, and how can they be addressed?

Expressing recombinant Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6 presents several challenges that researchers commonly encounter:

  • Low expression levels: As a membrane protein, expression levels are often suboptimal in conventional systems.

    • Solution: Optimize expression using specialized E. coli strains like C41(DE3) or C43(DE3) specifically designed for membrane proteins. Lowering induction temperature to 16-18°C and using lower IPTG concentrations (0.1-0.3 mM) can dramatically improve folding and yield. For particularly difficult constructs, consider switching to eukaryotic expression systems like Pichia pastoris, which often handle membrane proteins better than bacterial systems .

  • Protein aggregation and inclusion body formation:

    • Solution: Express the protein as a fusion with solubility-enhancing partners such as MBP, SUMO, or Fh8. Adding 5-10% glycerol and 1% glucose to the culture medium helps reduce inclusion body formation. If inclusion bodies still form, optimize refolding protocols using gradual dialysis with declining urea concentrations in the presence of appropriate detergents and lipids .

  • Improper cofactor incorporation:

    • Solution: Supplement expression media with riboflavin (10 μg/mL) to enhance FAD biosynthesis. During purification, include FAD (5-10 μM) in all buffers to ensure proper cofactor retention. For iron-sulfur cluster reconstitution, perform in vitro assembly using iron ammonium sulfate and sodium sulfide under anaerobic conditions after initial purification .

  • Proteolytic degradation:

    • Solution: Add protease inhibitor cocktails immediately after cell lysis and maintain low temperatures (0-4°C) throughout purification. Consider engineering constructs with terminal extensions that shield vulnerable protease sites. For particularly unstable constructs, express in E. coli strains lacking specific proteases like BL21(DE3) pLysS .

  • Loss of activity during purification:

    • Solution: Maintain reducing conditions with 1-5 mM DTT or 5-10 mM β-mercaptoethanol in all buffers. Use gentle detergents like DDM or digitonin at minimum effective concentrations. Consider adding lipids like phosphatidylcholine (0.02-0.05%) to stabilize the protein. Minimizing exposure to freeze-thaw cycles by preparing single-use aliquots significantly preserves activity .

By implementing these solutions systematically and optimizing conditions for this specific protein, researchers can overcome the challenging nature of expressing functional membrane proteins from chloroplasts .

How can researchers distinguish between specific activity of the recombinant protein and background activity from contaminating proteins?

Distinguishing between specific NAD(P)H-quinone oxidoreductase activity of the recombinant Nuphar advena protein and background activity from contaminants requires rigorous experimental controls and validation approaches:

  • Implement multiple purification steps:

    • Employ sequential chromatography techniques (affinity, ion exchange, size exclusion) to achieve >95% purity.

    • Analyze fractions from each purification step for both protein content (SDS-PAGE) and enzyme activity to ensure activity co-purifies with the target protein band.

    • Calculate specific activity (activity per mg protein) for each fraction to verify enrichment correlates with purification .

  • Use specific inhibitors and controls:

    • Include known inhibitors of NAD(P)H-quinone oxidoreductases (e.g., dicoumarol at 10-50 μM) in parallel assays. The recombinant enzyme should show characteristic inhibition patterns.

    • Test activity with closely related substrates with varying specificity profiles to match the expected substrate preference pattern of the authentic enzyme.

    • Prepare control preparations from expression systems containing empty vectors to identify any background host activities .

  • Perform immunodepletion validation:

    • Use specific antibodies against the recombinant protein (or its affinity tag) to deplete it from samples.

    • Compare activity before and after immunodepletion; a significant decrease confirms the activity originates from the target protein.

    • As controls, use non-specific antibodies or pre-immune serum which should not affect enzyme activity .

  • Conduct site-directed mutagenesis:

    • Generate variants with mutations in catalytic residues known to be essential for activity.

    • These mutants should show significantly reduced activity while maintaining similar expression and purification profiles.

    • Comparing wild-type and mutant activities provides strong evidence that the observed activity stems from the recombinant protein .

  • Mass spectrometry validation:

    • Excise protein bands from activity-positive fractions and perform LC-MS/MS analysis.

    • Confirm the presence of peptides matching the expected sequence of Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6.

    • Identify any contaminating oxidoreductases that might contribute background activity .

By implementing these rigorous controls, researchers can confidently attribute measured enzymatic activities to the recombinant Nuphar protein rather than contaminants from the expression system .

What strategies can overcome the challenges of functional reconstitution of this membrane protein?

Functional reconstitution of Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6 into membrane systems that preserve native activity presents several challenges. The following strategies effectively address these issues:

  • Optimized detergent-to-protein ratios:

    • Systematically test detergent-to-protein ratios (typically 1:1 to 10:1 w/w) to find the optimal balance between solubilization and preservation of activity.

    • Use mild detergents like DDM (0.05-0.1%), digitonin (0.5-1%), or amphipols for initial solubilization.

    • Implement detergent screening platforms using activity assays to identify optimal detergent types and concentrations for this specific protein .

  • Lipid composition optimization:

    • Incorporate plant thylakoid membrane lipids, particularly monogalactosyldiacylglycerol (MGDG) and digalactosyldiacylglycerol (DGDG), at 0.1-0.5 mg/ml to mimic the native membrane environment.

    • Test reconstitution with varying lipid compositions and lipid-to-protein ratios (typically 10:1 to 100:1 w/w) to identify conditions that maximize activity.

    • Consider including plant sterols (0.01-0.05 mg/ml) which can significantly enhance stability of plant membrane proteins .

  • Reconstitution methodologies:

    • Direct incorporation: For rapid screening, direct incorporation of detergent-solubilized protein into preformed liposomes provides a quick assessment of function.

    • Detergent removal techniques: For more stable reconstitution, gradually remove detergent using Bio-Beads, dialysis, or cyclodextrin absorption. The rate of detergent removal significantly impacts proper insertion and orientation.

    • Co-reconstitution with partner proteins: Include other subunits of the NDH complex to enhance stability and activity, particularly focusing on direct interaction partners of subunit 6 .

  • Nanodiscs for single-protein studies:

    • Employ membrane scaffold protein (MSP) nanodiscs to isolate individual protein molecules in native-like membrane patches.

    • Optimize MSP-to-lipid-to-protein ratios for proper incorporation.

    • This approach is particularly valuable for biophysical characterization and single-molecule studies of the isolated subunit .

  • Activity verification in reconstituted systems:

    • Develop specialized assays to verify directional electron transport in reconstituted systems using membrane-impermeable electron acceptors.

    • Employ fluorescent probes to monitor membrane potential generation or dissipation during enzyme activity.

    • Use freeze-fracture electron microscopy or atomic force microscopy to verify proper protein insertion and distribution in the membrane .

These reconstitution strategies allow researchers to bridge the gap between studies of the isolated protein and understanding its function in its native membrane environment, providing crucial insights into how this subunit contributes to electron transport in chloroplasts .

What are the future research directions for Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6?

Future research on Nuphar advena NAD(P)H-quinone oxidoreductase subunit 6 presents several promising directions at the intersection of plant biochemistry, evolutionary biology, and applied biotechnology. Key research avenues include:

  • Structural biology approaches: Applying cryo-electron microscopy to resolve the high-resolution structure of the complete NDH complex from Nuphar, with particular focus on subunit 6 and its interactions within the complex. This structural information would provide unprecedented insights into how this ancient lineage of aquatic plants has adapted its electron transport machinery to underwater environments .

  • Synthetic biology applications: Engineering optimized versions of this protein into crop plants to enhance stress tolerance, particularly for conditions involving fluctuating light intensities or drought stress. The unique adaptations found in Nuphar's aquatic-adapted electron transport components could provide valuable genetic resources for crop improvement .

  • Evolutionary functional studies: Conducting comparative biochemical analyses between the Nuphar protein and homologs from diverse plant lineages, including other aquatic plants with independent evolutionary histories. Such studies would reveal convergent adaptations to aquatic photosynthesis and identify critical residues for engineering enhanced photosynthetic efficiency .

  • System-level integration studies: Investigating how this protein functions within the broader context of chloroplast metabolism, particularly exploring its role in alternative electron transport pathways that become critical under stress conditions. This research would connect molecular function to whole-plant physiology and ecological adaptation .

  • Applied environmental research: Examining how this protein's function is affected by changing environmental conditions, particularly elevated CO2 levels and temperature fluctuations associated with climate change. As a member of an ancient plant lineage, Nuphar's adaptations may provide insights into plant evolutionary responses to changing environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.