Recombinant Nuphar advena Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Expression System and Yield

ParameterDetail
Host OrganismEscherichia coli (optimized for eukaryotic protein folding)
TagN-terminal His-tag (affinity purification)
Purity>90% (SDS-PAGE)
Expression RegionFull-length mature protein (residues 1–508)

Purification Protocol

  1. Cell Lysis: Tris/PBS-based buffer with β-DDM detergent .

  2. Affinity Chromatography: Ni-NTA column for His-tag binding .

  3. Buffer Exchange: Stabilized in 50% glycerol for long-term storage .

Spectral Characteristics

  • Absorption Peaks: 435 nm (Soret band), 670–680 nm (Q<sub>Y</sub> transition) .

  • Fluorescence Emission: 77 K emission maxima at 695 nm (similar to native CP47) .

Functional Role in Photosystem II

CP47 anchors the PSII core by:

  1. Chlorophyll Coordination: Binds 16 chlorophyll a molecules and 4 β-carotenes .

  2. OEC Stabilization: Direct interaction with the Mn<sub>4</sub>CaO<sub>5</sub> cluster via extrinsic proteins (PsbO, PsbP) .

  3. Energy Transfer: Channels excitons to the D1/D2 reaction center .

Mutational Studies: Deletions in psbB disrupt PSII assembly, underscoring its structural necessity .

CP47 Across Species

SpeciesUniprot IDKey DifferencesFunctional Impact
Nuphar advenaQ4FFN0Unique N-terminal His-tag for recombinant studiesEnhanced purification yield
Cyanophora paradoxaP48103Longer C-terminal extension (509 residues)Altered chlorophyll binding
Spinacia oleraceaP12345Higher thermostabilityAdaptation to high-light stress

Current Applications

  • Structural Biology: Cryo-EM studies resolve CP47’s role in PSII dimerization .

  • Photosynthesis Engineering: Mutagenesis to enhance light-harvesting efficiency .

  • Biotechnological Tool: Used to study PSII assembly intermediates .

Future Directions

  • Drug Discovery: Targeting CP47 for herbicides disrupting PSII .

  • Synthetic Biology: Engineering CP47 variants for artificial photosynthesis systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Nuphar advena (Common spatterdock) (Nuphar lutea subsp. advena)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP ISPSWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKALRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVNAGLAENLSLSE SWSKIPDKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGHELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELDGVSYNDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function

Recombinant Nuphar advena Photosystem II CP47 chlorophyll apoprotein (psbB) is a core component of the Photosystem II (PSII) complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-driven photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase; it utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient used for ATP synthesis.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbB gene and what role does it play in photosynthesis?

The psbB gene encodes the CP47 chlorophyll apoprotein, a core component of Photosystem II (PSII) found in the thylakoid membranes of chloroplasts. This protein plays a critical role in light harvesting and energy transfer during the light-dependent reactions of photosynthesis. CP47 functions as an internal antenna protein that collects light energy and transfers it to the reaction center of PSII where water is oxidized and electrons are transferred to the electron transport chain. The protein binds multiple chlorophyll molecules and carotenoids that facilitate this energy capture and transfer process. CP47's structure and positioning within PSII are essential for maintaining the proper architecture of the reaction center and ensuring efficient photosynthetic electron transport .

How is the psbB gene organized within the chloroplast genome?

The psbB gene is part of a well-studied operon that contains five genes on the plus strand (psbB-psbT-psbH-petB-petD, with the last two containing introns) and one gene (psbN) on the minus strand. This complex operon produces over 20 accumulating transcripts that have been characterized in scientific literature. Transcriptional analysis has identified eight transcription start sites (TSS), at least 12 processed 5′ ends, and 17 3′ ends associated with this operon. The psbB gene itself is positioned at the beginning of this operon, and its expression is regulated through both transcriptional and post-transcriptional mechanisms. The operon's organization reflects the complex regulatory networks that control chloroplast gene expression in plants .

What is known about the transcript processing in the psbB operon?

Transcript processing in the psbB operon involves complex mechanisms that generate multiple RNA species. A key characteristic of 5′ ends in this operon is their clustered organization around dominant peaks, while 3′ termini tend to be more discrete. The heterodisperse nature of 5′ ends resembles degradation intermediates, possibly created by enzymes like RNase J that progressively stall when encountering secondary structures or bound proteins. In contrast, the discrete 3′ ends can be found in both coding and intergenic regions, representing a mixture of degradation intermediates and mature transcript termini. Specific 5′ ends have been well-characterized, including psbB-51, psbH-44 and -67, and petB-47. Similarly, known 3′ termini include psbT+60, +223, psbH+109, petB+67, petD+94, and psbN+39. These processing events are often regulated by specific RNA-binding proteins that ensure proper transcript maturation .

How do transcription initiation sites differ between PEP and NEP promoters in the context of psbB expression?

Transcription initiation in chloroplasts involves two distinct RNA polymerases: the plastid-encoded polymerase (PEP) and the nuclear-encoded polymerase (NEP), each recognizing different promoter elements. For psbB expression, the primary promoter (P psbB -171, at position 72,200) has been identified as PEP-dependent, showing conservation across species including barley. When PEP activity is compromised, as in albostrians mutants with sectors lacking PEP, NEP can become more active, sometimes promiscuously initiating transcription at sites not normally utilized in wild-type plants. Research suggests that approximately 400 total transcription start sites (TSS) exist in Arabidopsis when both PEP and developmentally regulated NEP promoters are considered, averaging one TSS every ~600 nucleotides. This frequency is not surprising given the AT-rich nature of plastid genomes, which increases the likelihood of functional PEP promoter -10 elements occurring by chance. When designing experiments to study psbB expression, researchers should consider the potential for alternative initiation sites and polymerase switching under different physiological or developmental conditions .

What methods are most effective for detecting and characterizing transcript termini in the psbB operon?

The most effective method for comprehensive detection and characterization of transcript termini in the psbB operon is Terminome-seq, which can simultaneously identify both 5′ and 3′ RNA ends. This approach involves treating RNA samples with tobacco acid phosphorylase (TAP) to distinguish between primary transcripts (with 5′ triphosphates) and processed transcripts (with 5′ monophosphates). Key methodological considerations include:

  • DNase I treatment of RNA samples to eliminate DNA contamination

  • Parallel processing of TAP-treated and untreated samples

  • Library construction methods that capture both 5′ and 3′ ends

  • Deep sequencing to ensure detection of low-abundance transcripts

  • Bioinformatic analysis using a +TAP/-TAP ratio threshold (typically ≥10) to identify true transcription start sites

Researchers should note that this threshold may exclude some known TSS, such as P atpE -430 and P psbN -32, which have +TAP/-TAP ratios <10. Complementary approaches like 5′ RACE should be employed to validate specific ends of interest. When applying these methods to Nuphar advena specifically, considerations should be made for species-specific variations in transcript processing, which may differ from model systems like Arabidopsis or tobacco .

What factors influence post-transcriptional processing of psbB transcripts?

Post-transcriptional processing of psbB transcripts is influenced by multiple factors including RNA-binding proteins, secondary structures, and environmental conditions. Several specific proteins have been identified that regulate the processing of transcripts within the psbB operon:

  • HCF107: Essential for the formation of the psbH -44 mature 5′ end

  • HCF152: Required for processing of both the petB -47 5′ end and the psbH +109 3′ end

  • CRP1: Necessary for processing the petB +67 mature 3′ end

  • mTERF6: Required for processing the petD +94 3′ end

RNA secondary structures, particularly stem-loops, play crucial roles in defining 3′ termini. For example, stem-loops define the 3′ ends at psbT +60 (which also defines the 3′ end of the antisense psbN transcript) and petD +94 (which also defines the 3′ end of the antisense rpoA transcript). The stability of these structures can affect the efficiency of processing and the accumulation of specific transcript forms. Environmental factors such as light conditions and developmental stage can also modulate the expression and processing of chloroplast transcripts. Researchers investigating psbB transcript processing should consider these various factors and their potential interactions when designing and interpreting experiments .

What experimental design considerations are critical when studying recombinant CP47 protein expression?

When studying recombinant CP47 protein expression, several critical experimental design considerations must be addressed:

  • Expression System Selection: Due to the large size (~56 kDa) and membrane-integrated nature of CP47, selecting an appropriate expression system is crucial. Bacterial systems often struggle with proper folding of photosynthetic membrane proteins, so researchers should consider eukaryotic expression systems like yeast, insect cells, or plant-based systems.

  • Purification Strategy: CP47 contains multiple transmembrane domains and associates with chlorophyll molecules, making purification challenging. A sequential approach combining detergent solubilization (typically with mild detergents like n-dodecyl-β-D-maltoside), followed by affinity chromatography and size exclusion chromatography is recommended.

  • Protein Stability Monitoring: CP47 can be unstable once removed from its native membrane environment. Buffer optimization should include screening different pH conditions (typically pH 6.0-8.0), salt concentrations, and stabilizing agents like glycerol or specific lipids.

  • Functional Assessment: Verification of properly folded recombinant CP47 should include spectroscopic analysis (absorption and fluorescence spectroscopy) to confirm chlorophyll binding, and potentially reconstitution assays with other PSII components to assess interaction capabilities.

  • Expression Tag Selection: While affinity tags facilitate purification, they can interfere with CP47 function or assembly. C-terminal tags are generally preferred over N-terminal tags, and cleavable tags should be considered if the native protein is required for downstream applications .

How can researchers effectively analyze the interaction between CP47 and other components of the photosystem II complex?

Researchers can employ multiple complementary approaches to analyze interactions between CP47 and other PSII components:

  • Co-immunoprecipitation and Pull-down Assays: Using antibodies specific to CP47 or to potential interacting partners can help identify protein-protein interactions. When working with recombinant proteins, tag-based pull-downs (His-tag, FLAG-tag) can be effective, though care must be taken to validate that tags don't disrupt native interactions.

  • Crosslinking Mass Spectrometry (XL-MS): This technique involves chemically crosslinking proteins in their native state, followed by proteolytic digestion and mass spectrometry analysis. XL-MS can identify specific amino acid residues involved in protein-protein interactions, providing structural insights into how CP47 interacts with other PSII components.

  • Förster Resonance Energy Transfer (FRET): By tagging CP47 and potential interaction partners with appropriate fluorophores, researchers can measure energy transfer as an indication of physical proximity. This technique is particularly useful for studying dynamic interactions in living systems.

  • Cryo-electron Microscopy: Recent advances in cryo-EM have enabled high-resolution structural analysis of membrane protein complexes like PSII. This approach can reveal the precise positioning of CP47 within the larger complex and its interfaces with other subunits.

  • Mutational Analysis: Systematic mutation of specific residues in CP47, followed by functional analysis of PSII assembly and activity, can identify regions critical for protein-protein interactions or complex stability .

What techniques are recommended for analyzing the chlorophyll binding properties of recombinant CP47?

Several specialized techniques are recommended for analyzing the chlorophyll binding properties of recombinant CP47:

  • Absorption Spectroscopy: The CP47 protein exhibits characteristic absorption peaks around 435 nm and 670-680 nm when properly bound to chlorophyll molecules. Comparative analysis of these spectral features between native and recombinant proteins provides initial validation of correct pigment binding.

  • Circular Dichroism (CD) Spectroscopy: CD can reveal information about the environment of bound chlorophylls and their orientation within the protein scaffold. The CD spectrum in the visible region (400-700 nm) is particularly informative for assessing chlorophyll-protein interactions.

  • Fluorescence Spectroscopy: Chlorophyll fluorescence emission and excitation spectra can provide detailed information about energy transfer processes within CP47. Fluorescence lifetime measurements further characterize the excited state properties of bound chlorophylls.

  • Resonance Raman Spectroscopy: This technique can provide detailed information about the vibrational modes of bound chlorophyll molecules, offering insights into their protein environment and any structural distortions that may occur upon binding.

  • Pigment Extraction and HPLC Analysis: Quantitative extraction of pigments from purified CP47 followed by HPLC analysis allows determination of chlorophyll-to-protein stoichiometry and identification of specific chlorophyll species (chlorophyll a vs. b) bound to the recombinant protein .

What potential applications does research on Nuphar advena CP47 have beyond basic photosynthesis understanding?

Research on Nuphar advena CP47 extends beyond basic photosynthesis understanding to several promising application areas:

What are the current contradictions or unresolved questions in the research literature regarding CP47 function?

Several key contradictions and unresolved questions persist in the research literature regarding CP47 function:

  • Exact Energy Transfer Pathways: While CP47 is known to function in light harvesting and energy transfer to the PSII reaction center, the precise pathways and efficiency of energy transfer between specific chlorophyll molecules remain controversial. Different spectroscopic studies have suggested alternative models for these energy transfer networks.

  • Role in Photoprotection: There are conflicting reports regarding CP47's role in photoprotection mechanisms. Some studies suggest it participates actively in non-photochemical quenching, while others indicate it primarily serves as a light-harvesting component with minimal direct involvement in photoprotection.

  • Assembly Process: The precise sequence of events in PSII assembly, particularly the timing of CP47 incorporation relative to other components, remains incompletely understood. Some models suggest CP47 integration is an early event, while others propose it occurs at intermediate stages of complex assembly.

  • Specific Functions of Post-Transcriptional Processing: While numerous transcript processing events have been documented in the psbB operon, the functional significance of this complexity is not fully understood. For example, the specific roles of the multiple transcription start sites within and upstream of the psbB gene require further investigation.

  • Interaction with Novel Proteins: Recent proteomic studies have identified potential new interaction partners for CP47, but their functional significance and the nature of these interactions remain to be characterized .

What transcript termini have been identified in the psbB operon?

Extensive research using Terminome-seq has identified multiple transcript termini in the psbB operon, revealing a complex transcriptional and post-transcriptional regulatory landscape. The following table summarizes key transcript termini that have been characterized:

End typeGenome positionDescription and Notes
TSS 172,200P psbB -171, described in literature, also seen in barley
TSS 272,409Internal to psbB, potential distal promoter for psbT
TSS 374,393P psbH -92, previously described in literature
TSS 476,153Internal to petB exon 2, potential distal promoter for petD
TSS 576,375-76,376Upstream of petD
TSS 676,391Internal to petD intron
TSS 776,780Internal to petD intron
TSS 875,482Antisense to petB intron, potential distal promoter for psbN
Processed 5′ end 172,320psbB -51 mature end, previously described
Processed 5′ end 474,418psbH -67 mature end, described as precise endoribonuclease cleavage
Processed 5′ end 574,441psbH -44 mature end, main psbH 5′ end, processing depends on HCF107
Processed 5′ end 674,794petB -47 mature end, processing depends on HCF152
3′ end 674,2423′ end of psbT (psbT +60), defined by stem loop
3′ end 974,814psbH +109 mature end, processing depends on HCF152
3′ end 1076,358petB +67 mature end, processing depends on CRP1
3′ end 1477,7653′ end of petD (petD +94), defined by stem loop

This table represents a subset of the total termini identified. The psbB operon contains at least 12 processed 5′ ends and 17 3′ ends in addition to the 8 transcription start sites. Many of these termini show excellent correlation with previously published work, validating the Terminome-seq approach for comprehensive transcript end mapping .

How effective are extraction methods for studying antimicrobial properties of Nuphar advena?

Research on the extraction and testing of antimicrobial properties from Nuphar advena has yielded significant insights into methodological approaches. Traditional harvesting methods employed by Ojibwe people involve women collectors using bare feet to loosen sediment and snap roots with their toes, a practice that respects cultural traditions while effectively obtaining rhizome material. Modern scientific extraction and testing approaches have demonstrated measurable antimicrobial activity:

What factors should be considered when interpreting contradictory data about CP47 function and structure?

When interpreting contradictory data about CP47 function and structure, researchers should consider several critical factors:

What are the most promising areas for future research on Nuphar advena CP47?

The most promising areas for future research on Nuphar advena CP47 span both fundamental and applied science domains. From a fundamental perspective, comparative analyses between Nuphar advena CP47 and that of model organisms could reveal evolutionary adaptations specific to aquatic environments. Such studies might identify unique amino acid substitutions that influence protein stability, pigment binding, or energy transfer efficiency under variable light conditions characteristic of aquatic habitats. Additionally, detailed investigation of the transcript processing mechanisms in the Nuphar advena psbB operon could uncover species-specific regulatory elements that contribute to environmental adaptation. From an applied science perspective, exploring the potential connection between photosynthetic efficiency and secondary metabolite production in Nuphar advena represents a promising research direction. The documented antimicrobial properties of this plant warrant investigation into whether stress responses involving the photosynthetic apparatus might trigger production of bioactive compounds. Furthermore, structural studies of CP47 from Nuphar advena could inform bioengineering efforts aimed at enhancing photosynthetic efficiency in crop plants, particularly for cultivation in challenging light environments .

How might interdisciplinary approaches enhance our understanding of both photosynthetic and medicinal properties of Nuphar advena?

Interdisciplinary approaches hold significant potential for advancing our understanding of Nuphar advena's dual importance in photosynthesis research and traditional medicine. Combining ethnobotanical knowledge with modern scientific techniques represents a particularly valuable approach. The traditional use of Nuphar advena by Ojibwe people as an antiseptic provides important contextual information that can guide scientific investigation. Molecular biology approaches focused on gene expression profiles can help identify correlations between environmental stressors, photosynthetic adaptations, and production of bioactive compounds. Structural biology techniques applied to both photosynthetic proteins like CP47 and potential bioactive molecules could reveal functional relationships between these different aspects of plant physiology. Ecological studies examining how habitat conditions influence both photosynthetic efficiency and secondary metabolite profiles would provide valuable insights into the plant's adaptive strategies. Finally, pharmacological screening informed by traditional knowledge but employing modern high-throughput technologies could identify novel bioactive compounds while respecting and validating indigenous knowledge systems. This multifaceted approach would not only advance scientific understanding but could also contribute to addressing challenges in pharmaceutical resistance while honoring traditional ecological knowledge .

What methodological innovations would most benefit research on complex chloroplast gene expression and protein function?

Several methodological innovations would significantly benefit research on complex chloroplast gene expression and protein function, particularly in the context of the psbB operon and CP47:

  • Long-read Sequencing Technologies: Current techniques like Terminome-seq provide valuable information about transcript ends but cannot always definitively link 5′ and 3′ ends to specific transcript isoforms. Long-read sequencing technologies that can capture full-length transcripts would enhance our understanding of the complex transcript population emerging from operons like psbB.

  • Single-Molecule Approaches: Techniques such as single-molecule FRET (smFRET) or single-molecule tracking could provide dynamic information about CP47 assembly into PSII, energy transfer processes, and protein-protein interactions at unprecedented resolution, overcoming limitations of ensemble measurements.

  • Improved Membrane Protein Expression Systems: Development of expression systems specifically optimized for challenging membrane proteins like CP47 would facilitate structural and functional studies. This might include specialized lipid nanodiscs or cell-free expression systems that provide the appropriate environment for proper folding and cofactor incorporation.

  • Integrative Multi-omics Platforms: Platforms that integrate transcriptomic, proteomic, and metabolomic data could reveal connections between chloroplast gene expression, protein function, and metabolic outputs, particularly valuable for understanding plants like Nuphar advena with both photosynthetic and pharmacological significance.

  • Advanced Computational Models: Machine learning approaches trained on existing structural and functional data could help predict the impact of sequence variations on CP47 function, potentially identifying critical residues that contribute to species-specific adaptations or that might be targets for bioengineering efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.