Recombinant Nycticebus coucang NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Nycticebus coucang NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a genetically engineered protein derived from the mitochondrial genome of the slow loris (Nycticebus coucang). This 98-amino acid polypeptide is a subunit of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), which catalyzes electron transfer from NADH to ubiquinone during oxidative phosphorylation . Its recombinant form enables biochemical and biomedical research without requiring native tissue extraction.

Expression and Purification

ParameterSpecification
Host SystemEscherichia coli
TagN-terminal His tag (determined post-production)
Purity>90% (SDS-PAGE verified)
Storage-20°C in Tris-based buffer with 50% glycerol
ReconstitutionLyophilized powder in deionized water

Functional Role in Mitochondrial Complex I

  • Electron Transport: Facilitates the first step of oxidative phosphorylation by transferring electrons from NADH to ubiquinone .

  • Pathogenic Mutations: The Val65Ala mutation (T10663C) in humans disrupts Complex I activity, leading to Leber hereditary optic neuropathy . While not directly observed in Nycticebus coucang, this highlights the protein’s functional sensitivity.

  • Species-Specific Variations: Comparative studies in chickens and rodents reveal conserved residues (e.g., transmembrane helices) but divergent nucleotide frequencies in mitochondrial DNA regions encoding ND4L .

Comparative Mitochondrial Studies

  • Phylogenetic analyses of ND4L sequences in Nycticebus coucang and other primates inform evolutionary relationships and mitochondrial genome conservation .

  • Used to study mitochondrial dysfunction in neurodegenerative diseases due to its structural similarity to human ND4L .

Biochemical Assays

  • Quantification of Complex I activity in mitochondrial preparations (e.g., turnover number: 19 ± 1 pmol/mg protein in murine models) .

  • Stability testing under varying pH and temperature conditions .

Research Findings and Challenges

  • Mitochondrial Diversity: Studies on Nycticebus coucang spinal ganglia reveal mitochondrial heterogeneity, with light cells containing filamentous mitochondria and dark cells showing vacuolated structures . This underscores the need for recombinant tools to isolate ND4L’s role in mitochondrial morphology.

  • Technical Limitations: Low yield in E. coli expression systems (~1 mg/L) and insolubility issues necessitate optimization (e.g., codon usage, chaperone co-expression) .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve ubiquinone-binding mechanisms.

  • Disease Modeling: Engineering pathogenic mutations (e.g., Val65Ala) to study Leber neuropathy in vitro.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of that tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Nycticebus coucang (Slow loris)
Target Names
Target Protein Sequence
MPLISTNILLAFITALLGVLIYRSHLMSSLLCLEGMMLSMFILVSLTTMNLHFTLANIAP LILLVFAACEAAVGLALLVMVSNTYGMDYIQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of MT-ND4L protein?

MT-ND4L is a hydrophobic protein component of the mitochondrial respiratory Complex I (NADH:ubiquinone oxidoreductase). In humans, the MT-ND4L gene is located in mitochondrial DNA from base pair 10,469 to 10,765 and produces an 11 kDa protein composed of 98 amino acids . The protein functions as part of the core transmembrane domain of Complex I, which is essential for the first step of the electron transport process - transferring electrons from NADH to ubiquinone during oxidative phosphorylation .

The ND4L protein works within mitochondria to convert energy from food into ATP through a process called oxidative phosphorylation. As part of Complex I, it contributes to creating an unequal electrical charge across the inner mitochondrial membrane by facilitating electron transfer, ultimately providing energy for ATP production .

How does the structure of Nycticebus coucang MT-ND4L differ from human MT-ND4L?

The Nycticebus coucang (slow loris) MT-ND4L shares similarities with human MT-ND4L but contains certain species-specific amino acid variations. While both perform similar functions in the respiratory chain, the slow loris variant demonstrates differences in hydrophobicity profiles and possibly post-translational modifications.

The slow loris MT-ND4L sequence (UniProt: Q94Z64) consists of 98 amino acids with the sequence: MPLISTNILLAFLITALLGVLIYRSHLLMSSLLCLEGMLSMFILVSLTTMNLHFTLANPIAPLILLVFAACEAAVGLALLVMVSNTYGMDYIQNLNLLQC . Comparative analysis reveals that while the core functional domains remain conserved across species, primate-specific variations exist that may relate to the evolutionary adaptations in energy metabolism observed in different primates .

What unique feature characterizes the genomic organization of MT-ND4L?

An unusual feature of the human MT-ND4L gene is the 7-nucleotide gene overlap with the MT-ND4 gene. Specifically, the last three codons of MT-ND4L (5'-CAA TGC TAA-3' coding for Gln, Cys, and Stop) overlap with the first three codons of MT-ND4 (5'-ATG CTA AAA-3' coding for Met-Leu-Lys). With respect to the MT-ND4L reading frame (+1), the MT-ND4 gene starts in the +3 reading frame: [CAA][TGC][TAA]AA versus CA[ATG][CTA][AAA] . This overlapping genomic organization represents an evolutionary adaptation for compact mitochondrial genome organization and creates interdependencies in the expression and processing of these genes.

What are the recommended methods for recombinant production of MT-ND4L?

Recombinant production of MT-ND4L presents significant challenges due to its hydrophobic nature and complex assembly requirements. Researchers typically employ the following methodological approach:

  • Gene synthesis and codon optimization: Due to the hydrophobic nature of MT-ND4L, codon optimization for the expression system is critical for improving protein yield.

  • Expression system selection: E. coli-based systems with specialized strains (such as C41(DE3) or C43(DE3)) designed for membrane protein expression are often used. Alternatively, eukaryotic systems including yeast, insect cells, or mammalian cells may provide better folding environments.

  • Fusion tag strategies: Employing solubility-enhancing tags (MBP, SUMO, or GST) at the N-terminus can improve expression and purification outcomes. These tags can be removed post-purification using specific proteases.

  • Detergent screening: A systematic screening of detergents is essential for extracting and stabilizing the recombinant protein from membranes.

When expressing Nycticebus coucang MT-ND4L specifically, researchers have reported better results using eukaryotic expression systems with appropriate signal sequences to ensure proper localization and folding .

What advanced genetic engineering techniques have been used to study MT-ND4L function?

Recent advances in mitochondrial genome editing have revolutionized MT-ND4L research. The MitoKO (Mitochondrial Knockout) library of DdCBEs (DddA-derived cytosine base editors) has been used to generate precise mutations in MT-ND4L. In one noteworthy study, researchers modified the MT-ND4L sequence by changing a coding sequence for Val90 and Gln91 (GTC CAA) into Val and STOP (GTT-TAA) through the deamination of two consecutive cytosines on the coding strand .

The process involved:

  • Designing TALE domains binding to mtDNA strands

  • Creating DdCBE pairs with different combinations of the 1333 DddA-tox split

  • Targeting a 14-20bp sequence in the mitochondrial ORF

  • Transfection into cells followed by FACS to enrich the population expressing the MitoKO DdCBEs

  • Multiple rounds of transfection and recovery to achieve high levels of the desired mutation

This methodology achieved an effectively homoplasmic cell line with a premature stop codon in MT-ND4L, allowing for detailed functional analysis of the resulting phenotype .

How can researchers quantify MT-ND4L expression in experimental systems?

Accurate quantification of MT-ND4L expression is crucial for understanding its regulation and function. Researchers can employ several complementary techniques:

  • Quantitative RT-PCR: TaqMan Gene Expression Assays can be used for quantitative measurement of mitochondrial gene expression, including MT-ND4L. This method provides high sensitivity and specificity for transcript quantification .

  • Northern blot analysis: For analysis of small RNA molecules, this technique can be used with specific probes to detect MT-ND4L transcripts. The stability and mitochondrial import of RNA molecules can be assessed by comparing signals in total and mitochondrial RNA preparations .

  • Western blot analysis: Though technically challenging due to the small size and hydrophobic nature of MT-ND4L, optimized protocols using specific antibodies enable protein quantification.

  • ELISA: Commercial recombinant protein standards (such as those available for Nycticebus coucang MT-ND4L) can be used to generate standard curves for quantification .

  • Mitochondrial isolation and complex I activity assays: These provide functional readouts of properly assembled MT-ND4L within the respiratory complex.

For accurate results, researchers should normalize expression data to appropriate mitochondrial and nuclear reference genes, and consider mitochondrial copy number variations that might affect interpretation of results .

How does MT-ND4L contribute to the assembly of mitochondrial Complex I?

MT-ND4L plays a critical role in the assembly and stability of mitochondrial Complex I. Studies have demonstrated that the absence of ND4L polypeptides prevents the assembly of the 950-kDa whole complex I and suppresses enzyme activity .

As one of the core hydrophobic subunits of Complex I, MT-ND4L is integrated into the membrane arm during the early stages of complex assembly. Research with Chlamydomonas reinhardtii (where ND4L is nucleus-encoded rather than mitochondrion-encoded) has provided valuable insights into the assembly pathway:

  • MT-ND4L integrates with other hydrophobic ND subunits to form the membrane domain subcomplex

  • This subcomplex serves as a scaffold for the assembly of additional modules

  • The peripheral arm containing the catalytic subunits is attached to complete the L-shaped complex

The critical nature of MT-ND4L is evidenced by experiments showing that its absence results in complete failure of Complex I assembly . This suggests MT-ND4L plays a structural role beyond its contribution to proton translocation or electron transfer.

What bioenergetic consequences result from MT-ND4L dysfunction?

MT-ND4L dysfunction leads to cascading bioenergetic failures that affect cellular metabolism and homeostasis. When MT-ND4L is mutated or absent, several key metabolic disturbances occur:

  • Electron transport disruption: Failure of Complex I assembly prevents NADH oxidation and electron transfer to ubiquinone, disrupting the first step of the electron transport chain .

  • Reduced ATP production: The proton gradient necessary for ATP synthesis is compromised, resulting in decreased ATP production and energy deficiency.

  • Metabolomic alterations: MT-ND4L mutations have been associated with specific metabolite ratio changes, particularly affecting glycerophospholipid and sphingolipid metabolism. For example, the missense mutation rs879102108 (G>A) at position 10689 in MT-ND4L shows significant associations with altered ratios of phosphatidylcholines (PC ae C34:2/PC aa C36:6) with a beta value of 0.637 (p = 1.92 × 10^-8) .

  • ROS production: Dysfunctional Complex I often leads to increased reactive oxygen species production, causing oxidative stress and further mitochondrial damage.

  • Mitochondrial dynamics disruption: MT-ND4L dysfunction affects mitochondrial fission/fusion balance and quality control mechanisms, potentially leading to accumulation of damaged mitochondria .

These bioenergetic consequences manifest differently across tissues, with high-energy-demanding tissues like the central nervous system, retina, and cardiac muscle being particularly vulnerable to MT-ND4L dysfunction.

How are mutations in MT-ND4L associated with Leber Hereditary Optic Neuropathy (LHON)?

Mutations in MT-ND4L have been identified in several families with Leber Hereditary Optic Neuropathy (LHON), a maternally inherited eye disease characterized by rapid, painless, bilateral loss of central vision, typically affecting young adults .

The T10663C (Val65Ala) mutation in MT-ND4L has been specifically identified in LHON cases. This mutation changes a single amino acid in the NADH dehydrogenase 4L protein, replacing valine with alanine at position 65 . While the exact pathogenic mechanism remains unclear, this mutation likely:

  • Alters the hydrophobic core of the transmembrane region of Complex I

  • Disrupts proton translocation across the inner mitochondrial membrane

  • Affects Complex I stability or assembly

  • Leads to bioenergetic deficiency in retinal ganglion cells and their axons

Interestingly, in some Chinese families with LHON associated with the G11778A mutation in MT-ND4, additional mutations in MT-ND4L contribute to the high penetrance and expressivity of visual loss . This suggests genetic modifiers within the mitochondrial genome influence disease severity and penetrance.

A particularly striking observation in some families is that LHON associated with MT-ND4L mutations predominantly affects female matrilineal relatives. For example, in one study, nine females out of 21 matrilineal relatives (13 females/8 males) were affected, exhibiting late-onset/progressive visual impairment with a wide range of severity .

What experimental approaches can be used to study MT-ND4L mutations and their pathogenic mechanisms?

Researchers employ multiple complementary approaches to investigate MT-ND4L mutations:

  • Transmitochondrial cybrid models: Patient-derived mitochondria containing MT-ND4L mutations are transferred to ρ0 cells (lacking mtDNA) to create cellular models with identical nuclear backgrounds but different mitochondrial genotypes .

  • Base editing of mtDNA: The MitoKO system using DdCBEs allows for precise introduction of mutations in MT-ND4L within cells. This approach can create models with controlled heteroplasmy levels of specific mutations .

  • Mitochondrially targeted nucleic acids: Oligoribonucleotides complementary to mutant mtDNA regions can be delivered into mitochondria using vectors based on naturally imported RNAs (like 5S rRNA derivatives). This approach can potentially reduce the proportion of mutant mtDNA .

  • Biochemical analysis of Complex I: Spectrophotometric assays of NADH:ubiquinone oxidoreductase activity provide functional assessment of mutations. Blue Native PAGE combined with in-gel activity assays can evaluate complex assembly and function.

  • High-resolution respirometry: Measures oxygen consumption in intact cells or isolated mitochondria to assess the functional impact of mutations on respiratory capacity.

These approaches collectively enable the characterization of how MT-ND4L mutations affect complex assembly, enzyme kinetics, ROS production, and cellular bioenergetics.

What therapeutic strategies are being developed to address MT-ND4L mutations?

Several promising therapeutic approaches target MT-ND4L mutations and other mitochondrial gene defects:

  • Heteroplasmy shifting: Using mitochondrially imported RNAs as vectors, oligoribonucleotides complementary to mutant mtDNA regions can specifically reduce the proportion of mutant mtDNA. This approach has been demonstrated to decrease the proportion of mtDNA bearing large deletions in transmitochondrial cybrid cells .

  • Base editing: MitoKO DdCBE systems allow for the introduction of specific mutations in mtDNA, which could potentially be adapted to correct pathogenic mutations .

  • Bypass strategies: Small molecules that can bypass Complex I defects by facilitating electron transfer from NADH to ubiquinone through alternative pathways.

  • Mitochondrial replacement therapy: Though more applicable to preventing maternal transmission than treating existing patients, this technique replaces mutated mtDNA with donor mtDNA.

  • Gene therapy: AAV-mediated delivery of functional MT-ND4L or related genes has shown promise in animal models of LHON, though primarily focused on the more common ND4 and ND6 mutations thus far.

For MT-ND4L mutations specifically, research is still at an early stage, with heteroplasmy shifting and bypass strategies showing the most immediate potential for clinical application.

How does MT-ND4L vary across primate species and what are the evolutionary implications?

MT-ND4L shows interesting evolutionary patterns across primate species with potentially significant functional implications:

  • Sequence conservation vs. variation: While the core functional domains of MT-ND4L are relatively conserved across primates, specific amino acid variations exist. These variations may reflect adaptations to different metabolic requirements.

  • Evolutionary rate differences: Studies suggest that certain mitochondrial genes, including MT-ND4L, show different evolutionary rates in simian primates compared to other mammals. Some subunits of the electron transport chain appear to have undergone episodes of adaptive evolution in primate lineages .

  • Primate-specific features: The MT-ND4L gene in Nycticebus coucang (slow loris) and other primates shows unique features that may represent adaptations to primate-specific energetic demands.

Evolutionary analysis of MT-ND4L sequences across primates reveals that while some regions maintain strict conservation (likely due to functional constraints), other regions show primate-specific substitutions. These patterns suggest potential episodes of positive selection that may have contributed to adaptations in mitochondrial energy production during primate evolution .

What unique aspects of MT-ND4L genetics exist in Nycticebus coucang compared to humans?

The Nycticebus coucang (slow loris) MT-ND4L exhibits several notable differences from the human counterpart:

  • Sequence divergence: While maintaining core functional domains, the slow loris MT-ND4L contains species-specific amino acid substitutions that may affect protein-protein interactions within Complex I.

  • Codon usage: The codon usage patterns differ from human MT-ND4L, potentially affecting translation efficiency in this species.

  • Nuclear mitochondrial DNA segments (NUMTs): Interestingly, in some primate species like Macaca leonina (closely related to slow loris), D-loop-like NUMT haplotypes have been identified, suggesting potential evolutionary dynamics between mitochondrial and nuclear genomes . While not specifically documented for MT-ND4L in slow loris, similar dynamics may exist.

The study of Nycticebus coucang MT-ND4L provides valuable comparative insights for understanding the evolution of mitochondrial function in primates, particularly for a species that diverged relatively early in primate evolution. This comparative approach may help identify key functional domains and species-specific adaptations in mitochondrial energy production .

How do nucleus-encoded versus mitochondrially-encoded ND4L proteins differ in structure and function?

While MT-ND4L is typically encoded in the mitochondrial genome in most eukaryotes, including humans and Nycticebus coucang, there are exceptions. In the green alga Chlamydomonas reinhardtii, ND4L is encoded in the nuclear genome (designated NUO11) . This evolutionary relocation offers insights into structural and functional adaptations:

  • Hydrophobicity differences: Nuclear-encoded ND4L proteins typically show lower hydrophobicity compared to their mitochondrially-encoded counterparts. This adaptation facilitates their import into mitochondria after cytosolic synthesis .

  • Targeting sequences: Nuclear-encoded ND4L contains mitochondrial targeting sequences that direct the protein to mitochondria after synthesis, a feature unnecessary in mitochondrially-encoded versions.

  • Codon optimization: Nuclear-encoded ND4L genes display codon usage patterns optimized for cytosolic translation machinery, whereas mitochondrially-encoded versions use the mitochondrial genetic code.

  • Functional equivalence: Despite these differences, both nuclear and mitochondrially-encoded ND4L proteins serve the same essential role in Complex I assembly and function. Research shows that suppression of nuclear-encoded ND4L expression prevents Complex I assembly just as effectively as mutations in mitochondrially-encoded versions .

This comparative analysis between nucleus-encoded and mitochondrially-encoded ND4L provides important insights into the structural requirements for protein function versus requirements imposed by the site of protein synthesis and subsequent targeting.

Table 1: Key Properties of Recombinant Nycticebus coucang MT-ND4L

PropertySpecificationNotes
UniProt AccessionQ94Z64Nycticebus coucang MT-ND4L
Protein Length98 amino acidsFull-length protein
Molecular Weight~11 kDaWithout post-translational modifications
Recommended BufferTris-based buffer, 50% glycerolOptimized for protein stability
Storage Conditions-20°C for extended storageAvoid repeated freezing/thawing
Amino Acid SequenceMPLISTNILLAFIITALLGVLIYRSHLLMSSLLCLEGMLSMFILVSLTTMNLHFTLANPAILLVFAACEAAVGLALLVMVSNTYGMDYIQNLNLLQCFull sequence from UniProt
Enzyme ClassificationEC= 1.6.5.3NADH dehydrogenase activity

Table 2: Significant MT-ND4L Genetic Variants Associated with Metabolic Changes

PositionVariant IDNucleotide ChangeEffectAllele FrequencyAssociated Metabolite RatioBeta ValueP-valueMetabolite Class
10689rs879102108G > AMissense0.00139PC ae C34:2/PC aa C36:60.6371.92 × 10^-8Glycerophospholipid/glycerophospholipid
10689rs879102108G > AMissense0.00139PC ae C36:3/PC aa C36:60.6375.12 × 10^-8Glycerophospholipid/glycerophospholipid
10689rs879102108G > AMissense0.00139PC ae C36:1/PC aa C36:60.7662.22 × 10^-7Glycerophospholipid/glycerophospholipid
10689rs879102108G > AMissense0.00139PC ae C36:2/PC aa C36:60.6372.49 × 10^-7Glycerophospholipid/glycerophospholipid
10689rs879102108G > AMissense0.00139SM (OH) C14:1/PC aa C36:60.624.04 × 10^-7Sphingolipids/glycerophospholipid

Data from first mitochondrial genome-wide association study with metabolomics .

Table 3: Comparison of MT-ND4L Across Selected Primate Species

SpeciesProtein LengthSequence Identity with Human (%)Notable Features
Homo sapiens (Human)98 aa100%Reference sequence
Nycticebus coucang (Slow loris)98 aa~85%Early-diverging primate
Macaca mulatta (Rhesus macaque)98 aa~92%Contains NUMTs of mitochondrial genes
Pan troglodytes (Chimpanzee)98 aa~98%High conservation with human
Gorilla gorilla (Gorilla)98 aa~97%High conservation with human

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.