Recombinant Nycticeius humeralis Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Nycticeius humeralis (Evening bat) (Vespertilio humeralis)
Target Names
Target Protein Sequence
MTNIRKTHPLAKIINNSLIDLPAPSNISSWWNFGSLLGICLGLQILTGLFLAMHYTADTA TAFNSVTHICRDVNYGWVLRYLHANGASMFFICLYLHVGRGIYYGSYLYKETWNMGVVLL FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGNDLVEWIWGGFSVDKATLT
Uniprot No.

Target Background

Function
Recombinant Nycticeius humeralis Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane, which is essential for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Nycticeius humeralis Cytochrome b (MT-CYB)?

Nycticeius humeralis Cytochrome b (MT-CYB) is a mitochondrial protein isolated from the Evening bat (Vespertilio humeralis). It functions as a critical component of the electron transport chain, specifically as part of Complex III (ubiquinol-cytochrome c reductase complex). The protein is encoded by the mitochondrial genome and is essential for cellular respiration. In recombinant form, this protein is expressed in various systems for research applications, with a typical molecular weight characteristic of mitochondrial cytochrome b proteins .

The protein has several alternative designations in the scientific literature, including Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, and Ubiquinol-cytochrome-c reductase complex cytochrome b subunit. These nomenclature variations reflect its functional role in different experimental contexts and historical naming conventions .

How does Nycticeius humeralis MT-CYB compare to cytochrome b from other Chiroptera species?

Nycticeius humeralis cytochrome b shares significant sequence homology with other bat species, reflecting evolutionary conservation of this critical mitochondrial protein. When conducting comparative analysis, researchers should note that cytochrome b is frequently used as a molecular marker for phylogenetic studies within Chiroptera due to its relatively slow evolutionary rate in conserved regions and faster evolution in variable regions.

In research contexts, MT-CYB sequence analysis from N. humeralis has contributed to understanding the evolutionary relationships among vespertilionid bats. The protein serves as an excellent model for studying mitochondrial genome evolution in Chiroptera, which represents approximately 20% of all mammalian species. Unlike many other mammals, bats show interesting patterns of molecular evolution in their mitochondrial genes, potentially related to their high metabolic demands during flight .

What expression systems are available for recombinant Nycticeius humeralis Cytochrome b production?

Researchers have multiple expression system options for producing recombinant N. humeralis Cytochrome b, each with distinct advantages for different experimental applications. The selection of an appropriate expression system depends on research requirements regarding protein folding, post-translational modifications, and experimental applications.

Expression SystemProduct Code ExampleAdvantagesBest Applications
E. coliCSB-EP654993NAAX1High yield, cost-effective, rapid productionStructural studies, antibody production, protein-protein interaction assays
YeastCSB-YP654993NAAX1Better folding than bacterial systems, some post-translational modificationsFunctional studies requiring limited modifications
BaculovirusCSB-BP654993NAAX1Proper folding, post-translational modificationsComplex functional assays, structural studies requiring native conformation
Mammalian cellCSB-MP654993NAAX1Most authentic modifications, native conformationAdvanced functional studies, studies of protein-protein interactions in mammalian contexts

The E. coli system also offers a biotinylated variant (CSB-EP654993NAAX1-B) with an Avi-tag, produced through in vivo biotinylation using AviTag-BirA technology. This variant is particularly useful for applications requiring protein immobilization or detection using streptavidin-based systems .

What are the optimal storage conditions for maintaining MT-CYB stability?

To maintain optimal stability and activity of recombinant Nycticeius humeralis Cytochrome b, researchers should adhere to specific storage protocols. The recommended storage buffer consists of a Tris-based buffer with 50% glycerol, specifically optimized for this protein. For short-term storage (up to one week), the protein can be maintained at 4°C in working aliquots. For medium-term storage, -20°C is recommended, while long-term storage requires -20°C to -80°C .

Critical considerations for storage include:

  • Avoiding repeated freeze-thaw cycles, which can significantly degrade protein quality and activity

  • Preparing small working aliquots before freezing to minimize freeze-thaw events

  • Ensuring rapid freezing and slow thawing processes to minimize structural disruption

  • Maintaining appropriate protein concentration to prevent aggregation

For lyophilized powder preparations, reconstitution should be performed carefully, following manufacturer protocols to ensure proper solubilization while maintaining protein integrity .

How is the purity of recombinant MT-CYB determined and what level is required for different applications?

Standard recombinant Nycticeius humeralis Cytochrome b preparations typically achieve >85% purity as determined by SDS-PAGE analysis. This purity level is sufficient for most standard research applications, including antibody production, basic protein-protein interaction studies, and preliminary structural analyses .

For different research applications, varying purity levels may be required:

ApplicationRecommended Minimum PurityAnalytical Method
Basic antibody production>80%SDS-PAGE
ELISA development>90%SDS-PAGE, HPLC
Structural studies>95%SDS-PAGE, HPLC, Mass spectrometry
Functional assays>90%SDS-PAGE, Activity assays
Crystallography>99%Multiple methods including gel filtration

Researchers should verify protein purity using at least two independent methods when conducting advanced structural or functional studies. For applications requiring higher purity than the standard >85%, additional purification steps such as size exclusion chromatography or ion exchange chromatography may be necessary.

How can recombinant MT-CYB be utilized in ELISA development and optimization?

Developing and optimizing ELISA protocols using recombinant Nycticeius humeralis Cytochrome b requires careful consideration of multiple parameters. The ELISA Recombinant Nycticeius humeralis Cytochrome b (MT-CYB) can be used as either a capture antigen or as a standard for quantification .

Key considerations for ELISA optimization include:

  • Coating Concentration: For direct coating, concentrations between 1-10 μg/mL typically yield optimal results, though this should be empirically determined for each application.

  • Buffer Selection:

    • Coating buffer: Carbonate buffer (pH 9.6) generally provides good adsorption to plates

    • Blocking buffer: 3-5% BSA or non-fat dry milk in PBS with 0.05% Tween-20

    • Sample/antibody dilution buffer: PBS with 1% BSA and 0.05% Tween-20

  • Optimization Strategies:

    • Perform checkerboard titrations to determine optimal concentrations of antigen, primary antibody, and secondary antibody

    • Consider capture antibody orientation for sandwich ELISAs when measuring native cytochrome b

    • Evaluate detection limits using serial dilutions of recombinant standards

For specialized applications such as detecting native cytochrome b in bat tissue samples, additional considerations include sample preparation methods, potential cross-reactivity with cytochrome b from other species, and validation with appropriate controls.

What approaches can be used for studying protein-protein interactions involving MT-CYB?

Investigating protein-protein interactions involving Nycticeius humeralis Cytochrome b requires specialized techniques that account for its membrane-associated nature. Multiple complementary approaches are recommended to establish robust interaction data.

The biotinylated variant (CSB-EP654993NAAX1-B) offers particular advantages for interaction studies. This preparation utilizes AviTag-BirA technology, where E. coli biotin ligase (BirA) covalently attaches biotin to a specific lysine residue within the 15-amino-acid AviTag peptide with high specificity. This allows for oriented immobilization on streptavidin surfaces with minimal impact on protein function .

Recommended methodologies include:

  • Pull-down assays: Utilizing biotinylated MT-CYB immobilized on streptavidin beads to capture interacting partners from cellular lysates

  • Surface Plasmon Resonance: For quantitative measurement of binding kinetics and affinity constants, particularly useful for interactions with other components of the electron transport chain

  • Crosslinking-Mass Spectrometry: To identify interaction interfaces and conformational changes upon binding

  • Microscale Thermophoresis: For detecting interactions in solution with minimal protein consumption

When designing interaction studies, researchers should consider the native membrane environment of cytochrome b and potentially include appropriate detergents or lipid nanodiscs to maintain physiologically relevant conformations.

How is MT-CYB used in phylogenetic and evolutionary studies of Chiroptera?

Cytochrome b genes, including MT-CYB from Nycticeius humeralis, are widely used molecular markers for phylogenetic analysis of bats due to their appropriate rate of evolutionary change. The mitochondrial location, lack of recombination, and maternal inheritance make them particularly valuable for tracking evolutionary relationships.

When using recombinant MT-CYB in evolutionary studies, researchers typically:

  • Compare sequences across multiple bat species to reconstruct phylogenetic relationships

  • Analyze rates of nonsynonymous versus synonymous substitutions to identify regions under selective pressure

  • Evaluate the conservation of functional domains across evolutionary time

Recent phylogenetic studies incorporating bat cytochrome b data have revealed important insights into evolutionary relationships within Vespertilionidae, one of the largest and most diverse bat families. The Evening bat (Nycticeius humeralis) occupies an interesting phylogenetic position that helps resolve relationships among North American vespertilionid genera .

What considerations should researchers make when designing experiments involving parasites in bat hosts using MT-CYB?

When studying host-parasite relationships involving bats, MT-CYB can serve as both a marker for host identification and a tool for understanding molecular interactions. Research has shown that TcI, a discrete typing unit of Trypanosoma cruzi, has been detected in Chiroptera specimens, indicating the potential role of bats as reservoirs for this parasite .

Key considerations for such studies include:

  • Sampling Methodology: Non-lethal sampling techniques for bat specimens to minimize impact on bat populations while obtaining sufficient material for analysis

  • Molecular Detection Protocols: Optimized PCR protocols for simultaneous detection of bat MT-CYB (for species verification) and parasite markers

  • Evolutionary Considerations: Analysis of co-evolutionary relationships between bat hosts and their parasites using MT-CYB and parasite markers

  • Cross-reactivity Concerns: When developing detection assays, researchers must account for potential cross-reactivity between bat cytochrome b and similar proteins from parasites

A comprehensive experimental approach would include paired analysis of host (using MT-CYB markers) and parasite genetics, environmental factors, and physiological parameters of host-parasite interactions. Such studies contribute significantly to our understanding of zoonotic disease transmission and reservoir dynamics .

What are common challenges when working with recombinant MT-CYB and how can they be addressed?

Researchers working with recombinant Nycticeius humeralis Cytochrome b may encounter several challenges that can impact experimental outcomes. Recognizing and addressing these issues is crucial for successful research applications.

ChallengePotential CausesSolutions
Protein aggregationImproper reconstitution, freeze-thaw damageUse fresh aliquots, optimize buffer conditions, add stabilizing agents like glycerol
Loss of activityDenaturation, oxidationStore under recommended conditions, add reducing agents when appropriate
Poor binding in assaysImproper folding, blocked binding sitesTry different expression system variants, optimize assay buffers
Batch-to-batch variabilityExpression system differences, purification variationsEstablish internal standards, normalize against activity assays
Cross-reactivity in detectionAntibody non-specificityUse monoclonal antibodies, pre-absorb with related proteins

For applications requiring very high activity retention, researchers should consider using the mammalian cell-expressed variant (CSB-MP654993NAAX1), which typically maintains the most native conformation and activity profile .

How can researchers validate the identity and integrity of recombinant MT-CYB preparations?

To ensure experimental reproducibility and reliable results, researchers should implement comprehensive validation protocols for recombinant Nycticeius humeralis Cytochrome b preparations:

  • Identity Confirmation:

    • Mass spectrometry analysis to confirm the expected molecular weight

    • Peptide mapping following protease digestion

    • Western blot using antibodies specific to cytochrome b or included tags

  • Structural Integrity Assessment:

    • Circular dichroism to evaluate secondary structure elements

    • Thermal shift assays to measure conformational stability

    • Analysis of spectral properties characteristic of heme-containing proteins

  • Functional Validation:

    • Electron transfer activity assays where applicable

    • Binding assays with known interaction partners

    • Species-specific antibody recognition tests

A robust validation approach combines multiple orthogonal methods to provide confidence in protein identity, integrity, and functionality before proceeding with complex experiments .

What emerging applications exist for MT-CYB in comparative mitochondrial research?

Recombinant Nycticeius humeralis Cytochrome b has significant potential for advancing comparative mitochondrial research, particularly in understanding the unique metabolic adaptations of bats. Future research directions may include:

  • Comparative Functional Studies: Investigating the functional differences between cytochrome b from bats and other mammals to understand metabolic adaptations related to flight, echolocation, and longevity

  • Structure-Function Relationships: Detailed structural analysis of bat cytochrome b to identify unique features that may contribute to the exceptional longevity of bats relative to mammals of similar size

  • Mitochondrial Disease Models: Using bat cytochrome b as a comparative model to understand human mitochondrial diseases, potentially identifying protective mechanisms in bat mitochondria

  • Environmental Adaptation Studies: Examining variations in cytochrome b across bat species from different environmental niches to understand mitochondrial adaptations to environmental stressors

These emerging applications may provide valuable insights into fundamental questions of energy metabolism, aging, and evolutionary adaptation .

How might advances in protein engineering impact research applications of recombinant MT-CYB?

Protein engineering approaches are expanding the potential applications of recombinant Nycticeius humeralis Cytochrome b in research. Several innovative directions show particular promise:

  • Designer Fusion Proteins: Creating fusion constructs combining MT-CYB with fluorescent reporters or proximity labeling enzymes to track localization and interactions in living systems

  • Stability Engineering: Introducing strategic mutations to enhance stability while maintaining functionality, potentially allowing for expanded experimental conditions

  • Switchable Activity: Developing light- or chemical-responsive variants that allow for controlled activation of cytochrome b function in experimental systems

  • Custom Tag Configurations: Building upon the existing biotinylated variant (CSB-EP654993NAAX1-B) to develop multi-functional tagged versions for specialized applications

These protein engineering approaches may significantly expand the utility of recombinant MT-CYB in both basic research and applied biotechnology contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.