Recombinant Nyctinomops aurispinosus Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nyctinomops aurispinosus Cytochrome b

Recombinant Nyctinomops aurispinosus Cytochrome b (MT-CYB) is a laboratory-synthesized version of the cytochrome b protein derived from the mitochondrial genome of Peale's free-tailed bat (Nyctinomops aurispinosus). This protein is produced using recombinant DNA technology, typically expressed in Escherichia coli bacterial systems, enabling researchers to obtain sufficient quantities for various experimental applications .

Cytochrome b functions as a core subunit of Complex III (cytochrome bc1 complex) in the mitochondrial respiratory chain, playing a critical role in cellular energy production through oxidative phosphorylation. The protein contains binding sites for ubiquinol and forms part of the electron transport system that generates the proton gradient necessary for ATP synthesis .

The recombinant version of this protein provides a valuable research tool for studies of bat evolution, particularly within the Nyctinomops genus, as well as for comparative studies of mitochondrial function across species.

Recombinant Expression and Purification

The production of Recombinant Nyctinomops aurispinosus Cytochrome b involves several key steps:

  1. Gene synthesis or cloning of the MT-CYB coding sequence from Nyctinomops aurispinosus

  2. Insertion into appropriate expression vectors, often incorporating affinity tags

  3. Transformation into E. coli expression hosts

  4. Induction of protein expression under controlled conditions

  5. Cell lysis and protein extraction

  6. Purification through chromatographic methods

  7. Quality control testing via SDS-PAGE and other analytical techniques

The bacterial expression system (E. coli) provides an efficient platform for producing sufficient quantities of the recombinant protein for research applications . This approach overcomes the limitations of isolating the native protein directly from bat tissue, which would be impractical and raise ethical concerns.

Role in Mitochondrial Respiration

As a core component of respiratory Complex III, cytochrome b plays a central role in cellular energy production. The protein contains:

  1. Two heme groups (b<sub>H</sub> and b<sub>L</sub>)

  2. Binding sites for ubiquinol (Q<sub>o</sub> and Q<sub>i</sub> sites)

  3. Transmembrane domains that anchor it within the inner mitochondrial membrane

These structural features enable cytochrome b to participate in the Q-cycle, facilitating electron transfer and contributing to the proton gradient that drives ATP synthesis. Additionally, Complex III serves as one of the main sites of reactive oxygen species (ROS) production, which has implications for cellular signaling and potential oxidative damage .

Evolutionary Significance and Phylogenetic Applications

The mitochondrial cytochrome b gene has proven invaluable for phylogenetic studies due to its combination of conserved and variable regions. Specifically for Nyctinomops aurispinosus and related bat species, cytochrome b sequence data has contributed significantly to understanding evolutionary relationships.

Research has utilized approximately 513 base pairs of the cytochrome b gene to test hypotheses regarding relationships within the Nyctinomops genus . This molecular data helps establish the evolutionary history of these free-tailed bats and their position within the larger bat phylogeny.

The broader application of cytochrome b in bat phylogenetics has contributed to a comprehensive genealogy of Chiroptera, covering over 50% of bat species (648 terminal taxa) . This extensive analysis has provided insights into major evolutionary divisions within bats and their diversification patterns.

Phylogenetic and Evolutionary Studies

Recombinant Nyctinomops aurispinosus Cytochrome b provides a reference material for evolutionary studies focusing on:

  1. Species identification and taxonomic classification

  2. Population genetics of bat communities

  3. Divergence time estimation between bat lineages

  4. Comparative analyses of mitochondrial evolution

The protein and its encoding gene sequence serve as important markers in constructing time-calibrated species-level phylogenies of bats. Such phylogenies help elucidate the evolutionary history of bats and their adaptations to diverse ecological niches .

Comparative Biochemical Investigations

The availability of recombinant cytochrome b from Nyctinomops aurispinosus facilitates comparative studies with homologous proteins from other species. Research on human mitochondrial cytochrome b variants has demonstrated that specific mutations can significantly alter the protein's functional properties. For example:

  • The m.15257G>A mutation (p.Asp171Asn) increases sensitivity to the antimalarial drug atovaquone

  • The m.14798T>C mutation (p.Phe18Leu) enhances sensitivity to the antidepressant clomipramine

Similar investigations using the bat recombinant protein could reveal species-specific adaptations in mitochondrial function that might relate to the unique physiological demands of flight, echolocation, or hibernation in bats.

Immunological Research Applications

Recombinant Nyctinomops aurispinosus Cytochrome b can serve as an antigen for:

  1. Production of specific antibodies for immunodetection

  2. Development of immunoassays for species identification

  3. Immunohistochemical studies of mitochondrial distribution in bat tissues

These applications expand the utility of the recombinant protein beyond phylogenetic studies to include broader biological investigations of bat physiology and cell biology.

Comparison with Cytochrome b from Other Species

Research on cytochrome b variants has revealed significant functional consequences of even seemingly minor sequence differences. Studies in human mitochondrial cytochrome b showed that:

  1. Mutations in catalytic domains can alter enzyme activity and drug sensitivity

  2. Some polymorphisms previously considered "silent" actually modify complex III properties

  3. Specific mutations can affect interaction with inhibitors or other complex components

These findings suggest that species-specific variations in bat cytochrome b sequences might reflect functional adaptations to their unique ecological niches and physiological demands.

Use in Bat Phylogenetic Studies

The cytochrome b gene from Nyctinomops aurispinosus has contributed to comprehensive bat phylogenetic studies. Research has utilized this genetic marker to:

  1. Resolve relationships within the Nyctinomops genus

  2. Establish the position of this genus within the larger bat phylogeny

  3. Contribute to time-calibrated evolutionary trees of Chiroptera

Mitochondrial DNA Mutation Studies

While not specific to Nyctinomops aurispinosus, recent research on mitochondrial DNA, including cytochrome b, has revealed important patterns of mutation and their potential implications. For example, studies of COVID-19 patients identified:

  • 16 different mutations in the CYB gene, with 7 being missense mutations causing amino acid changes

  • Higher incidence of specific mutations (A15326G, T15454C, C15452A) in COVID-19 positive patients

  • No significant relationship between these mutations and patients' age or biochemical parameters

These findings highlight the potential broader significance of cytochrome b variations in health and disease contexts, suggesting avenues for future comparative research using bat proteins.

Expanded Phylogenomic Applications

As genomic technologies advance, cytochrome b data from Nyctinomops aurispinosus and other bat species will likely be integrated with broader genomic datasets to:

  1. Develop more comprehensive phylogenies with improved resolution

  2. Investigate patterns of molecular evolution across bat lineages

  3. Better understand the genetic basis of bat adaptations and specializations

The recombinant protein provides a valuable reference material for validating sequence data and understanding the structural implications of genetic variations.

Functional Studies of Bat-Specific Adaptations

Future research might explore functional properties of Nyctinomops aurispinosus cytochrome b in comparison with homologs from other species to investigate:

  1. Potential adaptations in energy metabolism related to flight energetics

  2. Biochemical properties that might contribute to bat longevity

  3. Species-specific responses to environmental stressors

Such comparative functional studies could reveal important insights into the evolutionary adaptations of bat mitochondrial function.

Potential Applications in Biodiversity Monitoring

The well-characterized nature of cytochrome b makes it a valuable marker for species identification in environmental DNA (eDNA) studies. Applications could include:

  1. Non-invasive monitoring of bat populations and diversity

  2. Assessment of habitat use and movement patterns

  3. Conservation planning for Nyctinomops and related bat species

These applications extend the utility of cytochrome b sequence data beyond traditional phylogenetic studies to address practical conservation challenges.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Nyctinomops aurispinosus (Peale's free-tailed bat)
Target Names
Target Protein Sequence
MTNIRKSHPLIKIVNDAFIDLPAPSNISSWWNFGSLLGVCLIVQILTGLFLAMHYTSDTA TAFNSVTHICRDVNYGWLLRYLHANGASMFFICLYLHIGRGLYYGSYTYTETWNVGVILL FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTELVQWIWGGLSVDKATLT
Uniprot No.

Target Background

Function

Recombinant Nyctinomops aurispinosus Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex), a crucial part of the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is essential for ATP synthesis, a fundamental process in cellular energy production.

Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Nyctinomops aurispinosus Cytochrome b (MT-CYB) and what is its biological significance?

Nyctinomops aurispinosus Cytochrome b (MT-CYB) is a mitochondrial protein encoded by the mitochondrial DNA (mtDNA) of Nyctinomops aurispinosus, a bat species in the Molossidae family. As with other mammalian cytochrome b proteins, it is predominantly a hydrophobic protein consisting of eight transmembrane helices that contains two heme groups and forms the ubiquinol and inhibitor binding sites (Q₀ and Q᷈ᵢ sites) . The protein serves as a critical component of mitochondrial complex III (cytochrome bc₁ complex) in the electron transport chain, playing essential roles in:

  • Energy conservation through proton gradient generation

  • Cellular respiration and ATP production

  • Reactive oxygen species (ROS) management

  • Maintaining mitochondrial function

In evolutionary biology research, MT-CYB sequences are particularly valuable as molecular markers for phylogenetic studies due to their moderate mutation rate and conservation across species .

What are the structural characteristics of Nyctinomops aurispinosus MT-CYB?

While the specific three-dimensional structure of Nyctinomops aurispinosus MT-CYB has not been fully characterized, we can infer its general structure based on homology with other mammalian cytochrome b proteins. The protein likely consists of:

  • Eight transmembrane alpha-helical domains spanning the inner mitochondrial membrane

  • Two heme groups (designated b₅₆₅ and b₅₆₂) that facilitate electron transfer

  • Two functional binding domains: the Q₀ site (ubiquinol oxidation) and Q᷈ᵢ site (ubiquinone reduction)

  • Conserved histidine residues that coordinate the heme groups

  • Regions that interact with other subunits of complex III

The protein's structure is critical for its function in the electron transport chain and for drug binding studies, particularly for compounds that target the Q sites.

How does recombinant MT-CYB differ from native MT-CYB isolated from Nyctinomops aurispinosus?

Recombinant Nyctinomops aurispinosus MT-CYB refers to the protein produced through molecular cloning and expression in laboratory systems rather than directly isolated from bat tissue. Key differences include:

FeatureRecombinant MT-CYBNative MT-CYB
SourceExpression systems (yeast, bacteria, insect cells)Isolated from bat mitochondria
PurityGenerally higher and more consistentVariable, contains native contaminants
Post-translational modificationsMay lack some or have altered modificationsContains all natural modifications
Tags and fusion partnersOften includes His-tags, GST, or other fusion partnersNo artificial tags or fusion partners
Functional propertiesMay have altered activity depending on expression systemNatural activity in mitochondrial context
Quantity obtainableScalable to research needsLimited by source material availability

The recombinant form allows for site-directed mutagenesis studies and production of sufficient quantities for structural and functional analyses that would be impossible with native protein due to the endangered status of many bat species and difficulty in obtaining sufficient tissue samples .

What expression systems are most effective for producing functional recombinant Nyctinomops aurispinosus MT-CYB?

The choice of expression system for recombinant MT-CYB is critical due to its hydrophobic nature and need for proper folding and integration into membranes. Based on cytochrome b research methodology, these systems offer different advantages:

  • Yeast expression systems: Particularly Saccharomyces cerevisiae has proven highly effective for expressing functional mitochondrial proteins, including cytochrome b variants. The yeast system provides an appropriate mitochondrial environment with the necessary chaperones and assembly factors .

  • Bacterial expression systems: These can be used with specialized vectors designed for membrane protein expression, but often yield lower amounts of functional protein.

  • Insect cell/baculovirus systems: These eukaryotic systems can provide better post-translational processing than bacterial systems.

For optimal expression of functional Nyctinomops aurispinosus MT-CYB, a modified approach based on established protocols for human MT-CYB in yeast is recommended, including:

  • Construction of plasmids carrying the intronless sequence of the MT-CYB gene

  • Site-directed mutagenesis for variant creation

  • Biolistic transformation for mitochondrial incorporation

  • Confirmation of homoplasmy to ensure uniform mitochondrial populations

What are the best methods for purifying recombinant Nyctinomops aurispinosus MT-CYB?

Purification of recombinant MT-CYB requires specialized techniques due to its hydrophobic nature and membrane localization. The recommended purification protocol involves:

  • Mitochondrial isolation:

    • Differential centrifugation to isolate mitochondria from expressing cells

    • Osmotic shock or sonication to release membrane fractions

  • Solubilization:

    • Gentle detergents (DDM, LMNG, or digitonin) to solubilize membrane proteins

    • Maintenance of critical micelle concentration throughout purification

  • Affinity chromatography:

    • Ni-NTA affinity chromatography if His-tagged

    • Optimization of imidazole concentrations to reduce non-specific binding

  • Size exclusion chromatography:

    • Further purification to isolate properly folded protein

    • Assessment of complex III formation if co-expressed with other subunits

  • Quality control:

    • Spectroscopic analysis to confirm heme incorporation

    • Activity assays to verify electron transport function

Proper detergent selection is crucial to maintain protein stability and activity throughout the purification process.

How can recombinant Nyctinomops aurispinosus MT-CYB be used for evolutionary studies?

Recombinant Nyctinomops aurispinosus MT-CYB provides powerful approaches for evolutionary biology research:

  • Functional assessment of evolutionary variants:

    • Express naturally occurring MT-CYB variants identified in different Nyctinomops populations

    • Measure biochemical differences in electron transport efficiency, ROS production, and inhibitor sensitivity

    • Correlate functional changes with ecological adaptations or geographic distribution

  • Experimental evolution studies:

    • Study the effects of specific amino acid changes at sites under positive selection

    • Reconstruct ancestral sequences to study evolutionary trajectories

    • Test how environmental pressures may have shaped MT-CYB function

  • Comparative functional genomics:

    • Express MT-CYB from different bat species in standardized yeast systems

    • Identify molecular adaptations in ecologically specialized species

    • Correlate sequence divergence with functional differences in energy metabolism

This approach has been successfully employed with human MT-CYB variants in yeast models to assess the functional impact of mutations located in or near catalytic domains . Similar methodologies can elucidate the evolutionary significance of sequence variations in Nyctinomops species, particularly in relation to their ecological adaptations and phylogenetic relationships .

What are the appropriate controls for studying recombinant Nyctinomops aurispinosus MT-CYB drug sensitivity?

When designing experiments to study drug sensitivity of recombinant Nyctinomops aurispinosus MT-CYB, multiple controls should be implemented:

  • Positive controls:

    • Wild-type MT-CYB from the same species

    • MT-CYB variants with known sensitivity profiles

    • Human MT-CYB with established responses to drugs like atovaquone and clomipramine

  • Negative controls:

    • Expression system without MT-CYB

    • MT-CYB with mutations in drug binding sites

    • Unrelated membrane proteins expressed in the same system

  • System-specific controls:

    • Yeast strains with native cytochrome b deleted or inactivated

    • Verification of homoplasmy in mitochondrial transformants

    • Growth conditions standardization (carbon source, oxygen level)

  • Methodological controls:

    • Solvent controls for drug vehicles (DMSO, ethanol)

    • Concentration gradients to establish dose-response relationships

    • Time-course experiments to capture temporal dynamics

For drug sensitivity testing specifically, implement established protocols similar to those used for human MT-CYB variants, which have successfully detected altered sensitivity to drugs like atovaquone (antimalarial) and clomipramine (antidepressant) in yeast models .

How do specific amino acid substitutions in Nyctinomops aurispinosus MT-CYB affect its function?

The functional impact of amino acid substitutions in MT-CYB depends on their location within the protein structure and the biochemical properties of the substituted residues. Based on studies of human MT-CYB variants in yeast models, several patterns have been observed that likely apply to Nyctinomops MT-CYB:

  • Catalytic domain substitutions:

    • Mutations in the Q₀ site can significantly alter ubiquinol binding, electron transfer efficiency, and sensitivity to Q₀ site inhibitors like atovaquone

    • Substitutions in the Q᷈ᵢ site may modify sensitivity to compounds like clomipramine

  • Transmembrane domain substitutions:

    • Can affect protein stability and integration into the mitochondrial membrane

    • May disrupt interactions with other complex III subunits

  • Heme coordination region substitutions:

    • Critical histidine mutations typically abolish function completely

    • Adjacent residue changes may alter redox properties of the heme groups

  • Surface residue substitutions:

    • Generally better tolerated but may affect protein-protein interactions

    • Can influence assembly of the complete complex III

To systematically evaluate the effects of specific substitutions, site-directed mutagenesis should be performed to create variants that are then expressed in a yeast system lacking functional endogenous cytochrome b. Functional assays including growth rates, oxygen consumption, complex III activity, and ROS production provide a comprehensive assessment of the impact .

How can I analyze sequence data from Nyctinomops aurispinosus MT-CYB to infer phylogenetic relationships?

Analyzing MT-CYB sequence data for phylogenetic inference requires a systematic approach:

  • Sequence preparation and alignment:

    • Clean raw sequences to remove primer regions and verify quality

    • Align sequences using MUSCLE, MAFFT, or ClustalW algorithms

    • Verify correct reading frame and absence of premature stop codons

    • For Nyctinomops studies, aim for at least 513 base pairs of comparable sequence regions as used in previous research

  • Model selection:

    • Determine the best-fit evolutionary model using jModelTest or ModelFinder

    • Common models for MT-CYB include GTR+G+I, HKY+G, or TN93

    • Consider codon-based models for coding regions

  • Tree construction methods:

    • Maximum Likelihood: Recommended for detailed evolutionary analysis

    • Bayesian Inference: Provides posterior probabilities of clades

    • Maximum Parsimony and Neighbor-Joining: Useful for comparison

  • Support assessment:

    • Bootstrap analysis (1000+ replicates) for ML and MP methods

    • Posterior probabilities for Bayesian analyses

    • Consider ultrafast bootstrap approximation for large datasets

  • Results interpretation:

    • Focus on well-supported nodes (bootstrap values >70% or posterior probabilities >0.95)

    • Compare topology with previous Nyctinomops phylogenies

    • Consider biogeographical context when interpreting relationships

  • Visualization and presentation:

    • Present trees with appropriate branch length scales

    • Indicate support values on key nodes

    • Include relevant outgroups from other Molossidae genera

Software recommendations include MEGA, MrBayes, RAxML, IQ-TREE, and FigTree for comprehensive phylogenetic analysis of Nyctinomops MT-CYB sequence data.

What statistical approaches are appropriate for analyzing MT-CYB functional data from experimental studies?

When analyzing functional data from MT-CYB experimental studies, the following statistical approaches are recommended:

  • For enzyme kinetics data:

    • Michaelis-Menten or Hill equations for substrate affinity analysis

    • Nonlinear regression for determining Km, Vmax, and Hill coefficients

    • ANOVA with post-hoc tests to compare kinetic parameters between variants

  • For inhibition studies:

    • IC50 determination using four-parameter logistic regression

    • Comparison of IC50 values using extra sum-of-squares F test

    • Ki calculation for competitive inhibitors

  • For complex III activity assays:

    • Paired t-tests or Wilcoxon signed-rank tests for comparing wild-type vs. variant

    • ANOVA with appropriate post-hoc tests for multiple variant comparisons

    • Mixed-effects models for time-course experiments

  • For growth and viability measurements:

    • Growth curve analysis using area under curve (AUC) comparisons

    • Survival analysis techniques for stress response experiments

    • Regression analysis for correlating sequence divergence with functional parameters

  • For ROS production studies:

    • Repeated measures ANOVA for time-dependent ROS generation

    • Correlation analysis between ROS levels and other functional parameters

Example data presentation for drug sensitivity comparison:

MT-CYB VariantComplex III Activity (% of WT)Atovaquone IC50 (nM)Clomipramine IC50 (μM)
Wild-type100 ± 512.5 ± 1.885.3 ± 7.2
p.Phe18Leu92 ± 710.2 ± 2.142.6 ± 5.9*
p.Asp171Asn97 ± 65.3 ± 1.4*79.8 ± 8.5

*Significantly different from wild-type (p < 0.01)

This approach parallels that used in studies of human MT-CYB variants, where specific mutations were found to significantly alter sensitivity to drugs like atovaquone and clomipramine .

How can I resolve contradictions between MT-CYB sequence-based phylogenies and morphological classifications in Nyctinomops species?

Resolving contradictions between molecular and morphological data in Nyctinomops taxonomy requires a comprehensive analytical approach:

  • Evaluate data quality and completeness:

    • Assess sequence quality, coverage, and potential contamination

    • Review morphological character definitions and measurement consistency

    • Consider sample size limitations in both datasets

  • Implement integrative taxonomic methods:

    • Conduct total evidence analyses combining molecular and morphological data

    • Apply partitioned analyses that allow different evolutionary models for each data type

    • Utilize Bayesian tip-dating methods that incorporate fossil calibrations

  • Address potential biological explanations:

    • Investigate incomplete lineage sorting using coalescent-based methods

    • Test for hybridization or introgression between Nyctinomops species

    • Consider differential selection pressures on MT-CYB versus morphological traits

  • Statistical approaches to quantify conflict:

    • Calculate incongruence length difference (ILD) test statistics

    • Implement SH or AU tests to compare alternative topologies

    • Apply Bayesian concordance analysis for multiple gene regions

  • Taxonomic resolution strategies:

    • Consider node dating and divergence time estimation

    • Integrate ecological and behavioral data as additional characters

    • Apply threshold criteria for species delimitation (e.g., GMYC, PTP, BPP)

  • Presentation of conflicting signals:

    • Visualize conflict using tanglegrams or consensus networks

    • Report support values from both datasets at conflicting nodes

    • Provide explicit discussion of areas of agreement and disagreement

This integrative approach has proven valuable in chiropteran systematics, particularly for resolving relationships within genetically similar but morphologically distinct bat populations.

What are common challenges in expressing recombinant Nyctinomops aurispinosus MT-CYB and how can they be overcome?

Recombinant expression of MT-CYB presents several challenges due to its hydrophobic nature and mitochondrial localization. Here are common issues and their solutions:

  • Poor expression levels:

    • Problem: Low protein yield in expression systems

    • Solutions:

      • Optimize codon usage for the expression host

      • Reduce expression temperature (e.g., 18-25°C)

      • Try different promoter strengths and induction conditions

      • Consider fusion partners that enhance solubility

  • Improper membrane integration:

    • Problem: Protein aggregation or mislocalization

    • Solutions:

      • Use specialized yeast strains designed for mitochondrial expression

      • Implement biolistic transformation for direct mitochondrial targeting

      • Co-express with chaperones or assembly factors

      • Optimize mitochondrial targeting sequences

  • Lack of heme incorporation:

    • Problem: Expressed protein lacks heme groups

    • Solutions:

      • Supplement growth media with δ-aminolevulinic acid

      • Ensure adequate iron availability in growth media

      • Verify expression of endogenous heme synthesis pathway

      • Use absorption spectroscopy to confirm heme incorporation

  • Heteroplasmy in mitochondrial transformants:

    • Problem: Mixed populations of mitochondrial DNA

    • Solutions:

      • Implement selection strategies to enrich for transformants

      • Verify homoplasmy through PCR analysis

      • Perform multiple rounds of selection on selective media

      • Use single-cell isolation to establish pure transformant lines

  • Functional assessment challenges:

    • Problem: Difficulty measuring activity of recombinant protein

    • Solutions:

      • Develop yeast growth-based assays in respiratory conditions

      • Implement in vitro electron transfer assays with purified components

      • Use oxygen consumption measurements as proxy for function

      • Assess drug sensitivity profiles as functional readouts

How can I verify the authenticity and quality of recombinant Nyctinomops aurispinosus MT-CYB?

Quality control of recombinant MT-CYB requires multiple analytical approaches:

  • Sequence verification:

    • DNA sequencing of expression constructs

    • RT-PCR confirmation of transcript expression

    • Mass spectrometry verification of protein sequence

  • Expression verification:

    • Western blotting with antibodies against MT-CYB or fusion tags

    • SDS-PAGE analysis of membrane fractions

    • Quantification against known standards

  • Structural integrity assessment:

    • Absorption spectroscopy to confirm heme incorporation (peaks at ~562 and ~565 nm)

    • Circular dichroism to verify secondary structure content

    • Thermal shift assays to assess protein stability

  • Functional verification:

    • Ubiquinol-cytochrome c reductase activity assays

    • Measurement of electron transfer rates

    • Inhibitor binding studies with known complex III inhibitors

    • Complementation assays in yeast strains lacking functional cytochrome b

  • Purity assessment:

    • Size exclusion chromatography profiles

    • Silver-stained SDS-PAGE to detect contaminants

    • Mass spectrometry analysis of final preparation

  • Homogeneity verification:

    • Dynamic light scattering to assess aggregation state

    • Blue native PAGE to analyze complex formation

    • Negative stain electron microscopy for complex visualization

Quality control benchmarks should be established using wild-type protein as a reference standard, with acceptance criteria for each parameter based on the intended experimental application.

What specific criteria should be used to determine if a recombinant MT-CYB construct is suitable for functional studies?

Before proceeding with functional studies, recombinant MT-CYB constructs should meet these critical quality criteria:

  • Sequence integrity:

    • 100% sequence identity with the designed construct

    • Absence of unintended mutations or reading frame shifts

    • Proper incorporation into mitochondrial DNA (in yeast systems)

  • Expression parameters:

    • Consistent expression levels between experimental replicates

    • Yield sufficient for planned experiments (typically >0.1 mg/L culture)

    • Proper localization to mitochondrial membranes

  • Structural integrity:

    • Characteristic absorption spectrum indicating proper heme incorporation

    • Thermal stability comparable to wild-type protein

    • Appropriate oligomeric state/complex formation

  • Functional benchmarks:

    • Electron transfer activity within 80% of wild-type levels

    • Expected inhibitor sensitivity profile

    • Ability to support respiratory growth in complementation systems

    • Proper integration into complex III

  • Technical robustness:

    • Reproducibility of preparation across multiple batches

    • Stability during storage (minimal activity loss over time)

    • Consistent behavior in experimental conditions

Example qualification criteria for MT-CYB functional studies:

ParameterAcceptance CriteriaMethod of Assessment
Sequence accuracy100% match to designDNA sequencing
Expression level≥0.2 mg/L cultureWestern blot quantification
Heme incorporationA565/A280 ratio ≥0.2UV-Vis spectroscopy
Complex III formation≥90% incorporationBlue native PAGE
Electron transfer activity≥80% of wild-typeCytochrome c reduction assay
Respiratory growthColony formation in 3-5 daysYeast complementation
Stability≤20% activity loss after 1 week at 4°CActivity retention testing

These criteria ensure that any functional differences observed between variants reflect genuine biological differences rather than technical artifacts or quality issues with the recombinant protein.

What are emerging applications of recombinant Nyctinomops aurispinosus MT-CYB in conservation biology?

Recombinant Nyctinomops aurispinosus MT-CYB offers several promising applications in conservation biology:

  • Population genetics and management:

    • Development of non-invasive genetic monitoring tools based on MT-CYB variants

    • Assessment of genetic diversity within fragmented populations

    • Identification of evolutionarily significant units for conservation prioritization

  • Functional adaptation studies:

    • Investigation of MT-CYB variants' roles in local adaptation to different environments

    • Correlation of functional properties with habitat requirements

    • Prediction of population vulnerability to environmental changes

  • Disease resistance research:

    • Exploration of MT-CYB variation in relation to pathogen resistance

    • Study of energetic adaptations that may influence disease susceptibility

    • Development of functional assays to predict population resilience

  • Biodiversity assessment:

    • Refinement of species boundaries within the Nyctinomops genus

    • Identification of cryptic species through integrated molecular and functional approaches

    • Enhancement of biodiversity inventories in understudied regions

  • Climate change response prediction:

    • Analysis of MT-CYB functional properties in relation to metabolic adaptation

    • Modeling of population responses to changing thermal regimes

    • Identification of populations with adaptive potential versus vulnerability

These applications build upon established methodologies in cytochrome b research while addressing the unique conservation challenges facing bat populations worldwide, which serve critical ecological roles but face numerous anthropogenic threats.

How might CRISPR-Cas9 technology be applied to study MT-CYB function in bat mitochondrial genetics?

CRISPR-Cas9 technology presents innovative approaches for studying MT-CYB function in bat mitochondrial genetics, though with unique challenges due to the mitochondrial location:

  • Mitochondrial genome editing strategies:

    • Targeted mitoTALENs or base editors fused with mitochondrial localization sequences

    • RNA import-based approaches to deliver guide RNAs to mitochondria

    • Bacterial cytidine deaminase fusions for C-to-T conversions in mtDNA

  • Cellular models for functional studies:

    • Generation of cybrid cell lines containing edited Nyctinomops MT-CYB

    • Creation of heteroplasmic cell models with varying proportions of edited mtDNA

    • Development of bat cell lines amenable to mitochondrial genome editing

  • Experimental applications:

    • Introduction of naturally occurring variants to study their functional effects

    • Engineering of ancestral MT-CYB sequences to study evolutionary trajectories

    • Creation of reporter systems to monitor MT-CYB function in live cells

  • Technical considerations:

    • Design of mitochondria-specific delivery systems for CRISPR components

    • Development of selection strategies for cells with edited mitochondrial genomes

    • Implementation of methods to increase homoplasmy of desired edits

  • Ethical and conservation perspectives:

    • Focus on cell culture models rather than whole-organism approaches

    • Emphasis on knowledge generation for conservation applications

    • Adherence to regulations regarding genetic studies of protected species

While significant technical hurdles remain for direct editing of mitochondrial genes, emerging technologies for mitochondrial DNA modification hold promise for advancing our understanding of MT-CYB function in bat species.

What computational approaches show promise for predicting functional effects of MT-CYB variations across bat species?

Advanced computational methods are increasingly valuable for predicting how MT-CYB variations affect protein function across bat species:

  • Homology modeling and molecular dynamics:

    • Construction of accurate 3D models based on crystallographic data from related species

    • Molecular dynamics simulations to predict stability changes from amino acid substitutions

    • Identification of altered interaction networks within complex III

  • Machine learning approaches:

    • Development of bat-specific prediction algorithms trained on known functional data

    • Integration of sequence conservation, physicochemical properties, and structural features

    • Implementation of deep learning models that capture complex sequence-function relationships

  • Evolutionary coupling analysis:

    • Identification of co-evolving residues that maintain functional constraints

    • Detection of compensatory mutations that preserve protein function

    • Prediction of epistatic interactions between multiple variants

  • Quantum mechanics/molecular mechanics (QM/MM):

    • Detailed modeling of electron transfer processes in wild-type and variant proteins

    • Calculation of activation energies for catalytic steps

    • Prediction of altered redox properties due to heme environment changes

  • Network-based approaches:

    • Analysis of protein-protein interaction networks affected by MT-CYB variations

    • Integration of transcriptomic and proteomic data with variant effects

    • Systems biology modeling of mitochondrial function with variant MT-CYB

  • Validation strategies:

    • Benchmarking computational predictions against experimental results

    • Development of consensus predictors that integrate multiple approaches

    • Iterative refinement of models based on new experimental data

These computational approaches can guide experimental design by prioritizing variants for functional testing and generating testable hypotheses about the mechanistic basis of functional differences observed between bat species with divergent ecological adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.