Recombinant Nyctinomops laticaudatus Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand that specific requirements may arise. To ensure your order is fulfilled accordingly, please clearly indicate your desired format in the order notes. We will make every effort to accommodate your request.
Lead Time
Delivery timelines can vary depending on the purchase method and location. For specific delivery estimates, kindly consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein using deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. To ensure optimal usage, aliquoting is essential for multiple applications. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Nyctinomops laticaudatus (Lesser broad-eared free-tailed bat) (Tadarida espiritosantensis)
Target Names
Target Protein Sequence
MTNIRKSHPLIKIVNDAFIDLPAPSNISSWWNFGSLLGVCLIVQILTGLFLAMHYTSDTA TAFNSVTHICRDVNYGWLLRYLHANGASMFFICLYLHIGRGLYYGSYTYTETWNVGVILL FAVMATAFMGYVLPWGQMSFWGATVITNLLFAIPYIGTELVQWIWGGLSVDKATLT
Uniprot No.

Target Background

Function
Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which plays a crucial role in the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, ultimately contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is then harnessed for ATP synthesis, a fundamental process in energy production within cells.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of MT-CYB in Nyctinomops laticaudatus?

Cytochrome b (MT-CYB) in Nyctinomops laticaudatus functions as a core subunit of complex III in the oxidative phosphorylation system. It plays a critical role in cellular energy production and homeostasis within bat mitochondria. The protein contains transmembrane helices that form two ubiquinol and inhibitor binding sites (Qo and Qi sites), which are essential for electron transport chain function and proton gradient generation across the inner mitochondrial membrane . As a key component of cellular respiration, MT-CYB is involved in ATP production and also represents a potential site for reactive oxygen species (ROS) generation, which can serve both signaling and potentially damaging functions in cellular processes .

How is Nyctinomops laticaudatus MT-CYB genetically distinct from other bat species?

Nyctinomops laticaudatus MT-CYB has been genetically characterized in DNA barcoding studies, showing a relatively low level of intraspecific genetic variation compared to other bat species. In comprehensive surveys of Neotropical bats, N. laticaudatus displayed a mean intraspecific distance of 0.13% and a maximum intraspecific distance of 0.47% based on cytochrome b sequence analysis . This level of genetic conservation suggests that N. laticaudatus maintains a single mitochondrial lineage across its range, unlike some other bat species such as Saccopteryx bilineata, which shows much higher genetic diversity (mean intraspecific distance of 2.10% and maximum of 9.99%) with three distinct lineages .

What are the optimal storage conditions for recombinant N. laticaudatus MT-CYB protein?

For optimal preservation of recombinant Nyctinomops laticaudatus MT-CYB protein activity and stability, follow these evidence-based storage protocols:

  • Short-term storage (up to one week): Store working aliquots at 4°C

  • Medium-term storage: Store at -20°C in a buffer containing 50% glycerol

  • Long-term storage: Conserve at -80°C in Tris-based buffer with 50% glycerol

Importantly, repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided . It is recommended to prepare small working aliquots upon initial thawing to minimize the need for refreezing the stock solution.

What expression systems are most effective for producing recombinant N. laticaudatus MT-CYB?

While the search results don't specifically detail expression systems for N. laticaudatus MT-CYB, effective approaches can be inferred from cytochrome b studies. Yeast expression systems have proven particularly valuable for functional studies of mitochondrial proteins, including cytochrome b variants . The advantage of yeast systems is that they are amenable to mitochondrial transformation, allowing for directed mutagenesis and subsequent biochemical/biophysical analysis of the resulting proteins .

For mammalian mitochondrial proteins, including bat MT-CYB, biolistic transformation using microprojectile bombardment has been successfully employed to introduce mutations into cytochrome b genes . This technique allows researchers to create homoplasmic strains containing only one mtDNA population with the desired modification, facilitating clear interpretation of functional studies .

How can researchers effectively design site-directed mutagenesis experiments for N. laticaudatus MT-CYB?

To conduct effective site-directed mutagenesis experiments with N. laticaudatus MT-CYB:

  • Start with a plasmid carrying the wild-type intron-less sequence of the mt-cyb gene

  • Employ a Quickchange Site-Directed Mutagenesis Kit or similar technology for introducing specific mutations

  • Verify the sequence after mutagenesis to confirm successful introduction of the desired mutation

  • Use the verified plasmids carrying the mutated genes for transformation into appropriate expression systems

  • Focus mutagenesis efforts on catalytic domains of MT-CYB, particularly the Qo and Qi sites, as these regions often produce the most functionally significant phenotypes when altered

For transformation into yeast mitochondria specifically, microprojectile bombardment has been demonstrated as an effective technique, resulting in homoplasmic strains that contain only the mutated mtDNA population .

How does sequence conservation in N. laticaudatus MT-CYB compare to other Molossidae family bats?

Nyctinomops laticaudatus shows remarkable sequence conservation within its species compared to other members of the Molossidae family. According to comprehensive DNA barcoding studies:

SpeciesSample Size (n)Mean Intraspecific Distance (%)Maximum Intraspecific Distance (%)Number of Lineages
Nyctinomops laticaudatus170.130.471
Nyctinomops macrotis1N/AN/AN/A
Molossus coibensis70.130.311
Molossus molossus1380.512.221
Molossus rufus480.801.721
Cynomops paranus140.753.812
Eumops hansae101.044.652

This data demonstrates that N. laticaudatus maintains one of the lowest levels of intraspecific sequence divergence among the Molossidae family members examined . This high conservation suggests strong selective pressure maintaining the functional integrity of cytochrome b in this species, potentially reflecting its ecological specialization or evolutionary history.

What phylogenetic insights can be gained from N. laticaudatus MT-CYB sequence analysis?

Cytochrome b sequence analysis of N. laticaudatus provides several important phylogenetic insights:

  • Evolutionary Conservation: The low intraspecific genetic distance (0.13% mean, 0.47% maximum) suggests strong purifying selection on MT-CYB in this species, indicating its critical functional importance

  • Taxonomic Stability: Unlike many other bat species that show evidence of cryptic diversity when analyzed with mtDNA markers, N. laticaudatus appears to represent a single evolutionary lineage across its range, supporting its current taxonomic classification

  • Biogeographic History: The lack of significant genetic structure in MT-CYB across N. laticaudatus populations may indicate relatively recent dispersal events or ongoing gene flow between populations, preventing mitochondrial lineage divergence

  • Comparison with Nuclear Markers: While mtDNA like cytochrome b provides one evolutionary perspective, researchers should note that nuclear markers might reveal different patterns of population structure that would complement the MT-CYB findings

This phylogenetic information is valuable for conservation assessments and understanding the evolutionary history of Molossidae bats in the Neotropical region.

How can recombinant N. laticaudatus MT-CYB be used to study drug interactions and sensitivity?

Recombinant N. laticaudatus MT-CYB offers a powerful model for studying drug interactions and sensitivity through several methodological approaches:

  • Yeast Expression System: By expressing N. laticaudatus MT-CYB in yeast mitochondria, researchers can examine how specific mutations affect sensitivity to various drugs that target complex III

  • Comparative Pharmacology: Studies of human cytochrome b have revealed that specific mutations can significantly alter sensitivity to drugs like atovaquone (antimalarial) and clomipramine (antidepressant) . Similar approaches can be applied to bat MT-CYB to explore species-specific drug interactions

  • Structure-Function Analysis: By introducing site-directed mutations in catalytic domains (particularly the Qo and Qi sites) of N. laticaudatus MT-CYB, researchers can map the structural basis of differential drug sensitivity between species

  • Natural Resistance Studies: Analysis of naturally occurring variations in bat MT-CYB can provide insights into potential resistance mechanisms against pathogens or environmental toxins that target mitochondrial function

This research has significant implications for understanding bat physiology, developing species-specific therapeutic approaches, and exploring evolutionary adaptations in drug sensitivity across mammalian lineages.

What insights can N. laticaudatus MT-CYB provide about mitochondrial disease mechanisms?

Studying N. laticaudatus MT-CYB can provide valuable insights into mitochondrial disease mechanisms through several research avenues:

  • Natural Variation Analysis: By examining the effects of naturally occurring variations in N. laticaudatus MT-CYB on complex III function, researchers can better understand how certain mutations might lead to mitochondrial dysfunction in humans

  • Disease-Associated Mutation Modeling: Human disease-associated MT-CYB mutations can be introduced into recombinant N. laticaudatus MT-CYB to create comparative models for studying pathogenic mechanisms in a controlled system

  • Oxidative Stress Responses: As MT-CYB is involved in ROS production, studying the N. laticaudatus protein can help elucidate how different species manage oxidative stress, potentially revealing protective mechanisms that could inform human disease treatments

  • Energy Metabolism Adaptations: Bats have unique energy metabolism requirements due to flight capabilities. Studying their MT-CYB can reveal adaptations that might protect against conditions similar to human metabolic disorders

These approaches can contribute to broader understanding of mitochondrial disease mechanisms and potentially identify novel therapeutic targets for human mitochondrial disorders.

How can researchers effectively analyze post-translational modifications of N. laticaudatus MT-CYB?

Effective analysis of post-translational modifications (PTMs) in N. laticaudatus MT-CYB requires multi-faceted approaches:

  • Mass Spectrometry-Based Identification:

    • Employ liquid chromatography-tandem mass spectrometry (LC-MS/MS) to identify specific PTMs

    • Use enrichment techniques such as immunoprecipitation with modification-specific antibodies prior to MS analysis

    • Apply both bottom-up (peptide-level) and top-down (intact protein) proteomics approaches for comprehensive PTM mapping

  • Site-Directed Mutagenesis Validation:

    • Create recombinant variants where potential PTM sites are replaced with non-modifiable amino acids

    • Compare functional properties between wild-type and mutant proteins to assess the physiological significance of each modification

  • In Vivo Verification:

    • Use tissue samples from N. laticaudatus to verify that PTMs identified in recombinant systems reflect those occurring naturally

    • Compare PTM patterns across different physiological states (e.g., hibernation, active flight) to identify context-dependent modifications

  • Evolutionary Conservation Analysis:

    • Compare PTM sites across related bat species to identify evolutionarily conserved modifications that likely serve critical functions

    • Evaluate conservation patterns against the background of low intraspecific variation (0.13% mean distance) observed in N. laticaudatus MT-CYB

These methodological approaches can reveal how PTMs regulate MT-CYB function and potentially contribute to the unique physiological adaptations observed in N. laticaudatus.

What are common challenges in expressing and purifying recombinant N. laticaudatus MT-CYB?

Researchers commonly encounter several challenges when working with recombinant N. laticaudatus MT-CYB:

  • Membrane Protein Solubility: As a highly hydrophobic protein with eight transmembrane helices, MT-CYB is inherently difficult to maintain in solution without appropriate detergents or membrane mimetics

  • Functional Integrity: Maintaining the proper folding and heme incorporation during recombinant expression is challenging but essential for functional studies

  • Expression System Selection: While bacterial systems offer high yield, eukaryotic systems (particularly yeast) are often necessary to ensure proper post-translational processing and mitochondrial targeting

  • Purification Optimization: The hydrophobic nature of MT-CYB necessitates careful optimization of detergent types and concentrations during purification to prevent protein aggregation while maintaining native structure

  • Storage Stability: Recombinant MT-CYB requires specific storage conditions (optimized buffer with 50% glycerol) and avoidance of freeze-thaw cycles to maintain activity

To address these challenges, researchers should consider using specialized expression systems like those developed for membrane proteins, optimize purification protocols specifically for hydrophobic proteins, and strictly adhere to recommended storage conditions.

How can researchers verify the functional integrity of recombinant N. laticaudatus MT-CYB?

To verify the functional integrity of recombinant N. laticaudatus MT-CYB, researchers should employ multiple complementary approaches:

  • Spectroscopic Analysis:

    • UV-visible spectroscopy to confirm proper heme incorporation by examining characteristic absorption peaks

    • Circular dichroism to assess secondary structure integrity, particularly important for confirming proper folding of transmembrane regions

  • Enzymatic Activity Assays:

    • Measure ubiquinol-cytochrome c reductase activity when incorporated into complex III

    • Compare activity parameters (Km, Vmax, inhibitor sensitivity) with native protein benchmarks

  • Structural Validation:

    • Use limited proteolysis to verify proper folding (correctly folded proteins show characteristic resistance patterns)

    • If possible, employ structural techniques like cryo-EM to confirm proper integration into complex III

  • Functional Complementation:

    • Express recombinant N. laticaudatus MT-CYB in yeast strains lacking functional cytochrome b and assess respiratory growth

    • Compare growth phenotypes and complex III activity between complemented strains and controls

  • Drug Sensitivity Profiling:

    • Test sensitivity to known complex III inhibitors like atovaquone or clomipramine, which can provide functional validation and reveal species-specific differences in binding site architecture

These validation steps ensure that any subsequent experimental results accurately reflect the native properties of N. laticaudatus MT-CYB rather than artifacts of recombinant production.

What emerging technologies could advance N. laticaudatus MT-CYB research?

Several cutting-edge technologies show promise for advancing research on N. laticaudatus MT-CYB:

  • Cryo-EM Structural Analysis:

    • High-resolution structural determination of N. laticaudatus complex III containing MT-CYB

    • Comparative structural analysis with human and other mammalian complexes to identify species-specific features

  • CRISPR-Based Mitochondrial Genome Editing:

    • Emerging technologies for direct editing of mitochondrial DNA could allow introduction of N. laticaudatus MT-CYB variants into mammalian cell lines

    • Creating heterologous expression systems that more closely mimic natural mitochondrial environments

  • Single-Molecule Functional Analysis:

    • Advanced techniques like single-molecule FRET to study conformational changes during catalytic cycles

    • Patch-clamp studies of purified and reconstituted protein to directly measure proton translocation

  • Systems Biology Integration:

    • Multi-omics approaches combining proteomics, metabolomics, and transcriptomics to understand MT-CYB function in broader metabolic networks

    • Computational modeling of species-specific differences in complex III function based on sequence variations

  • Evolutionary Medicine Applications:

    • Using comparative genomics between bat and human MT-CYB to identify potential therapeutic targets

    • Exploring bat-specific adaptations that might confer resistance to mitochondrial dysfunction

These technological advances could significantly enhance our understanding of N. laticaudatus MT-CYB biology and its potential applications in biomedical research.

How might research on N. laticaudatus MT-CYB contribute to conservation efforts?

Research on N. laticaudatus MT-CYB has several potential applications to bat conservation efforts:

  • Population Genetic Monitoring:

    • The low intraspecific variation (0.13% mean, 0.47% maximum) in N. laticaudatus MT-CYB provides a stable genetic marker for population monitoring

    • Any significant deviations from this established baseline could indicate population bottlenecks or isolation effects

  • Species Authentication and Forensics:

    • MT-CYB sequencing can be used for non-invasive species identification from environmental DNA samples

    • This approach helps monitor population distributions without disturbing bat colonies

  • Climate Change Vulnerability Assessment:

    • Comparing MT-CYB functional properties across temperature gradients can provide insights into thermal adaptation

    • This information helps predict population vulnerability to climate change scenarios

  • Genetic Diversity Conservation:

    • While N. laticaudatus shows low MT-CYB diversity (only one lineage observed), this information helps establish conservation priorities

    • Populations harboring any rare MT-CYB variants might require special conservation attention

  • Disease Susceptibility Prediction:

    • Functional studies of MT-CYB can reveal potential vulnerabilities to environmental toxins or pathogens

    • This information can inform preventative conservation strategies for protecting bat populations

These applications demonstrate how fundamental molecular research on MT-CYB can translate into practical conservation outcomes for N. laticaudatus and related bat species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.