Recombinant Nyctomys sumichrasti NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is Nyctomys sumichrasti MT-ND4L and how does it function in the electron transport chain?

Nyctomys sumichrasti MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a mitochondrial protein that functions as a core subunit of Complex I in the electron transport chain. This protein is encoded by the mitochondrial genome and plays a critical role in oxidative phosphorylation, the process by which cells generate ATP. The MT-ND4L protein contributes to the first step in the electron transport process, facilitating the transfer of electrons from NADH to ubiquinone. This electron transfer is coupled with proton pumping across the inner mitochondrial membrane, creating an electrochemical gradient that drives ATP synthesis.

The amino acid sequence of Nyctomys sumichrasti MT-ND4L consists of 98 amino acids: MTLVMFNITIAIFTLSLLGTLMFRTHLMSTLLCLEGMMLCLFIMAVITSLDTHPMIMYPIP IIILVFAACEAAVGLALLAMVSSTYGTDYVQNLNLLQC . This relatively small hydrophobic protein is embedded in the inner mitochondrial membrane and is essential for proper Complex I assembly and function.

How is recombinant Nyctomys sumichrasti MT-ND4L protein produced for research applications?

The production of recombinant Nyctomys sumichrasti MT-ND4L involves several standardized methodological steps. Initially, the MT-ND4L gene sequence must be obtained either through PCR amplification from Nyctomys sumichrasti mitochondrial DNA or via gene synthesis based on the known sequence. This gene is then inserted into an appropriate expression vector with a suitable tag to facilitate purification.

For expression, researchers typically select systems that can efficiently produce membrane proteins, which may include bacterial (E. coli), yeast (P. pastoris), insect cells (Sf9, Hi5), or mammalian cell lines. The recombinant protein produced through these systems includes a tag, though "the tag type will be determined during production process" , suggesting flexibility in tag selection based on experimental requirements.

Following expression, the protein undergoes purification using affinity chromatography, leveraging the attached tag. Additional purification steps often include size exclusion chromatography or ion exchange chromatography to achieve high purity. Quality control typically involves SDS-PAGE, Western blotting, and mass spectrometry to confirm identity, purity, and integrity of the recombinant protein.

What are the optimal storage and handling conditions for recombinant Nyctomys sumichrasti MT-ND4L?

Proper storage and handling of recombinant Nyctomys sumichrasti MT-ND4L is critical for maintaining its structural integrity and functional activity. The recommended storage conditions include:

• Storage buffer: Tris-based buffer with 50% glycerol, optimized specifically for this protein

• Long-term storage: -20°C; for extended storage periods, -20°C or -80°C is recommended

• Working aliquots: Store at 4°C for up to one week

• Important handling note: "Repeated freezing and thawing is not recommended"

The high glycerol content (50%) in the storage buffer serves multiple purposes: it prevents freezing damage, reduces protein aggregation, and stabilizes the protein's tertiary structure. The specific pH and ionic composition of the Tris-based buffer have been optimized for this particular protein.

Researchers should prepare single-use aliquots upon receipt to avoid repeated freeze-thaw cycles that can denature the protein. When planning experiments, it's advisable to thaw aliquots slowly on ice and centrifuge briefly before use to remove any potential aggregates.

What experimental techniques are most suitable for studying the function of recombinant Nyctomys sumichrasti MT-ND4L?

Several sophisticated experimental techniques are particularly well-suited for investigating the function of recombinant Nyctomys sumichrasti MT-ND4L:

• Complex I Activity Assays:

  • NADH:ubiquinone oxidoreductase activity measurements using spectrophotometric methods

  • Oxygen consumption analysis using oxygen electrodes or plate-based respirometry

  • Membrane potential measurements using fluorescent indicators (JC-1, TMRM)

• Protein-Protein Interaction Studies:

  • Blue Native PAGE to analyze Complex I assembly

  • Chemical crosslinking coupled with mass spectrometry to identify interacting partners

  • Co-immunoprecipitation with other Complex I subunits

• Structural Analysis:

  • Circular dichroism spectroscopy to assess secondary structure

  • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

  • Cryo-electron microscopy of reconstituted complexes

• Reconstitution Experiments:

  • Incorporation into proteoliposomes to assess activity in a membrane environment

  • Complementation studies in Complex I-deficient systems

  • Assembly assays to monitor integration into the holoenzyme

These methodological approaches provide complementary data that, when integrated, offer comprehensive insights into MT-ND4L's role in mitochondrial function and energy metabolism.

How does the amino acid sequence of Nyctomys sumichrasti MT-ND4L compare to MT-ND4L from other species?

Comparative analysis of MT-ND4L sequences across species reveals important evolutionary patterns and functionally significant regions. Below is a comparison between Nyctomys sumichrasti (Sumichrast's vesper rat) and Bos mutus grunniens (Wild yak) MT-ND4L:

Table 1: Sequence Comparison of MT-ND4L Proteins

Notable observations from this comparison:

• Both proteins are 98 amino acids in length

• The C-terminal region (TYGTDYVQNLNLLQC) is highly conserved, suggesting functional importance

• The central motif (LCLEGMM) is conserved between species, likely representing a critical functional domain

• N-terminal regions show greater variability, potentially reflecting species-specific adaptations

• Hydrophobic character is maintained throughout both sequences, consistent with membrane integration

This sequence conservation pattern indicates functionally critical regions that have been preserved through evolution, while allowing for species-specific adaptations in other regions.

What approaches can be used to validate the activity of recombinant Nyctomys sumichrasti MT-ND4L in vitro?

Validating the activity of recombinant Nyctomys sumichrasti MT-ND4L presents unique challenges since it functions as part of Complex I rather than as an independent enzyme. Researchers can employ several methodological approaches to assess its functionality:

• Reconstitution Experiments:

  • Incorporate recombinant MT-ND4L into proteoliposomes with other Complex I subunits

  • Measure NADH oxidation coupled to ubiquinone reduction

  • Assess proton pumping efficiency using pH-sensitive dyes

• Complementation Studies:

  • Introduce recombinant MT-ND4L into systems with defective or absent endogenous protein

  • Measure restoration of Complex I activity

  • Assess rescue of mitochondrial membrane potential and ATP production

• Electron Transfer Measurements:

  • Use artificial electron acceptors (e.g., ferricyanide) to bypass complete Complex I assembly

  • Monitor spectrophotometric changes indicating electron transfer

  • Compare activity with and without specific inhibitors (e.g., rotenone)

• Structural Integration Analysis:

  • Assess incorporation into Complex I using Blue Native PAGE

  • Perform protease protection assays to confirm proper membrane insertion

  • Use crosslinking to verify correct positioning relative to other subunits

Each of these approaches provides complementary evidence for the functional integrity of the recombinant protein, with the combination of multiple methods offering the most comprehensive validation.

What structural features of Nyctomys sumichrasti MT-ND4L are crucial for its function in Complex I?

The structural features of Nyctomys sumichrasti MT-ND4L that are critical for its function in Complex I can be inferred from sequence analysis and comparison with related proteins:

• Transmembrane Domains:

  • MT-ND4L is predicted to contain multiple transmembrane helices that anchor it in the inner mitochondrial membrane

  • These hydrophobic segments are essential for proper Complex I assembly and structural integrity

  • The transmembrane regions likely contribute to proton translocation channels

• Conserved Motifs:

  • The highly conserved C-terminal region (TYGTDYVQNLNLLQC) suggests important functional or structural roles

  • The central LCLEGMM motif is conserved across species and likely participates in critical interactions

• Charged Residues:

  • Strategically positioned charged amino acids may participate in proton translocation

  • These residues often form salt bridges that are important for protein stability

• N-terminal Region:

  • The N-terminal segment shows greater sequence variability between species

  • This region may be involved in species-specific interactions or adaptations

These structural features collectively enable MT-ND4L to fulfill its dual roles: contributing to the structural integrity of Complex I and participating in the coupled electron transfer/proton pumping mechanism that drives ATP synthesis.

What methods can be used to study the expression regulation of MT-ND4L in Nyctomys sumichrasti?

Investigating the expression regulation of MT-ND4L in Nyctomys sumichrasti requires specialized techniques that address the unique challenges of mitochondrial gene expression:

• Quantitative PCR Approaches:

  • Design primers specific to Nyctomys sumichrasti MT-ND4L

  • Extract total RNA from different tissues

  • Perform reverse transcription followed by qPCR

  • Normalize to appropriate mitochondrial reference genes

• Protein Detection Methods:

  • Develop antibodies against Nyctomys sumichrasti MT-ND4L or use cross-reactive antibodies

  • Perform Western blotting on tissue homogenates

  • Use immunohistochemistry for tissue localization studies

  • Employ mass spectrometry for absolute quantification

• In situ Hybridization:

  • Generate RNA probes specific to MT-ND4L

  • Perform fluorescence in situ hybridization on tissue sections

  • Visualize spatial distribution of MT-ND4L transcripts

• Mitochondrial Run-On Transcription Assays:

  • Isolate intact mitochondria from Nyctomys sumichrasti tissues

  • Measure transcription rates of MT-ND4L relative to other mitochondrial genes

  • Assess the impact of different physiological conditions on transcription

These methodological approaches enable researchers to characterize tissue-specific expression patterns, developmental regulation, and responses to physiological or environmental challenges.

What methodologies are effective for studying the integration of recombinant Nyctomys sumichrasti MT-ND4L into functional Complex I?

Investigating the integration of recombinant Nyctomys sumichrasti MT-ND4L into functional Complex I requires sophisticated methodological approaches:

• In vitro Reconstitution Systems:

  • Purify individual Complex I subunits or subcomplexes

  • Add recombinant MT-ND4L at different assembly stages

  • Monitor assembly progression using Blue Native PAGE

  • Measure functional parameters at each assembly step

• Import Assays with Isolated Mitochondria:

  • Isolate intact mitochondria from relevant cell types

  • Synthesize radiolabeled or fluorescently tagged MT-ND4L in vitro

  • Incubate with isolated mitochondria under varying conditions

  • Analyze import efficiency, membrane integration, and Complex I incorporation

• Proximity-Based Labeling:

  • Generate MT-ND4L fusion constructs with promiscuous biotin ligases (BioID, TurboID)

  • Express in appropriate cellular systems

  • Identify biotinylated proteins representing the integration neighborhood

  • Map the protein interaction landscape during assembly

• Time-Resolved Crosslinking:

  • Apply crosslinking at different stages of Complex I assembly

  • Identify crosslinked partners by mass spectrometry

  • Create a temporal map of MT-ND4L interactions during integration

• Cryo-Electron Microscopy:

  • Purify Complex I at different assembly stages with incorporated recombinant MT-ND4L

  • Perform structural analysis by cryo-EM

  • Identify conformational changes associated with MT-ND4L integration

These approaches collectively provide a comprehensive understanding of how MT-ND4L incorporates into Complex I and contributes to its assembly, stability, and function.

How can site-directed mutagenesis of recombinant Nyctomys sumichrasti MT-ND4L contribute to understanding mitochondrial disease mechanisms?

Site-directed mutagenesis of recombinant Nyctomys sumichrasti MT-ND4L offers powerful insights into mitochondrial disease mechanisms through several strategic approaches:

• Disease-Mutation Modeling:

  • Introduce mutations equivalent to those associated with human mitochondrial diseases

  • For example, create the rodent equivalent of the T10663C (Val65Ala) mutation linked to Leber hereditary optic neuropathy in humans

  • Assess functional and structural consequences

• Systematic Mutational Analysis:

  • Generate a comprehensive library of alanine-scanning mutants

  • Evaluate the impact on Complex I assembly, stability, and activity

  • Identify amino acid positions critical for function

• Pathogenic Mechanism Investigation:

  • For each mutation, measure:

    • NADH:ubiquinone oxidoreductase activity

    • Proton pumping efficiency

    • ROS production

    • Protein stability and half-life

    • Complex I assembly competence

• Structure-Function Correlation:

  • Map mutations onto structural models of Complex I

  • Correlate functional defects with structural perturbations

  • Identify critical domains for electron transfer and proton pumping

Table 2: Potential Disease-Relevant Mutations for Analysis in Nyctomys sumichrasti MT-ND4L

This systematic mutational approach provides a valuable experimental platform for understanding how specific amino acid changes lead to mitochondrial dysfunction and human disease.

What techniques are available for analyzing protein-protein interactions involving Nyctomys sumichrasti MT-ND4L?

Analyzing protein-protein interactions involving Nyctomys sumichrasti MT-ND4L requires specialized techniques that address the challenges of working with hydrophobic membrane proteins:

• Chemical Crosslinking Coupled with Mass Spectrometry:

  • Apply membrane-permeable crosslinkers to stabilize transient interactions

  • Digest crosslinked complexes and analyze by LC-MS/MS

  • Identify crosslinked peptides to map interaction interfaces

  • Quantify crosslinking efficiency to assess interaction strength

• Proximity-Dependent Biotinylation:

  • Create fusion proteins with BioID, TurboID, or APEX2

  • Express in appropriate cellular systems

  • Identify biotinylated proteins that interact with or are proximal to MT-ND4L

  • Map the spatial interaction network around MT-ND4L

• Bioluminescence/Förster Resonance Energy Transfer (BRET/FRET):

  • Generate fusion proteins with luminescent/fluorescent donors and acceptors

  • Express in mitochondria and measure energy transfer

  • Quantify interaction strength and dynamics in living systems

  • Assess effects of mutations or pharmacological agents on interactions

• Hydrogen-Deuterium Exchange Mass Spectrometry:

  • Compare hydrogen-deuterium exchange rates of MT-ND4L alone versus in complex

  • Identify regions with altered solvent accessibility

  • Map interaction interfaces at peptide-level resolution

• Co-evolution Analysis:

  • Perform statistical coupling analysis on multiple sequence alignments

  • Identify co-evolving residues as potential interaction sites

  • Validate predictions experimentally through mutagenesis

These complementary approaches provide a comprehensive understanding of how MT-ND4L interacts with other proteins within Complex I and potentially with other mitochondrial components.

How can recombinant Nyctomys sumichrasti MT-ND4L be utilized in comparative studies of Complex I efficiency across rodent species?

Recombinant Nyctomys sumichrasti MT-ND4L provides a valuable tool for comparative studies of Complex I efficiency across rodent species, offering insights into evolutionary adaptations in energy metabolism:

• Reconstituted Complex I Systems:

  • Create hybrid complexes with MT-ND4L from different rodent species

  • Measure NADH:ubiquinone oxidoreductase activity under standardized conditions

  • Compare kinetic parameters (Km, Vmax, catalytic efficiency)

  • Assess thermal stability and pH optima

• Energy Coupling Efficiency:

  • Measure P/O ratios (ATP synthesized per oxygen consumed)

  • Quantify proton pumping efficiency

  • Assess slip reactions (electron transfer without proton pumping)

  • Calculate thermodynamic efficiency under various conditions

• Environmental Adaptation Analysis:

  • Test performance under conditions mimicking different habitats:

    • Temperature ranges (cold-adapted vs. tropical species)

    • Oxygen tension variations

    • pH fluctuations

    • Substrate availability

Table 3: Comparative Analysis Framework for Rodent MT-ND4L Function

This comparative approach reveals how MT-ND4L has evolved to optimize mitochondrial function for specific ecological niches and physiological demands across rodent lineages.

What computational approaches can predict the functional impact of variations in Nyctomys sumichrasti MT-ND4L?

Advanced computational approaches offer powerful tools for predicting the functional impact of variations in Nyctomys sumichrasti MT-ND4L:

• Homology Modeling and Molecular Dynamics:

  • Build structural models based on related proteins with known structures

  • Simulate protein behavior in a membrane environment

  • Analyze changes in structural stability, flexibility, and conformational dynamics

  • Identify potential perturbations to proton channels or electron transfer pathways

• Evolutionary Analysis Tools:

  • Calculate conservation scores across species using ConSurf or similar tools

  • Apply algorithms like SIFT, PolyPhen-2, and PROVEAN to predict variant impacts

  • Use Evolutionary Action scores to quantify the evolutionary significance of mutations

  • Correlate sequence conservation with functional importance

• Machine Learning Approaches:

  • Train neural networks on known pathogenic mutations in related proteins

  • Integrate multiple features (conservation, physico-chemical properties, structural context)

  • Generate ensemble predictions from multiple algorithms

  • Validate predictions experimentally

• Network Analysis:

  • Model how variations affect the interaction network within Complex I

  • Predict propagation of structural perturbations

  • Simulate alterations in electron flow or proton pumping

  • Identify potential compensatory mutations

These computational approaches provide testable hypotheses about the functional consequences of natural variations or experimentally introduced mutations, guiding subsequent experimental investigations.

What are the challenges in developing cellular models to study Nyctomys sumichrasti MT-ND4L function?

Developing cellular models to study Nyctomys sumichrasti MT-ND4L function presents several significant methodological challenges:

• Mitochondrial Genetic System Limitations:

  • MT-ND4L is encoded by mitochondrial DNA, not nuclear DNA

  • Mitochondrial DNA is difficult to manipulate using standard genetic engineering techniques

  • Heteroplasmy (mixed populations of mitochondrial genomes) complicates genetic modifications

  • Limited tools exist for species-specific mitochondrial genome editing

• Expression System Considerations:

  • Allotopic expression (nuclear expression of mitochondrial genes) faces targeting challenges

  • Expression levels need precise control to avoid toxicity or aggregation

  • Post-translational modifications may differ between expression systems

  • Proper membrane insertion requires specialized machinery

• Functional Assessment Complexities:

  • MT-ND4L functions only as part of Complex I, not independently

  • Isolating MT-ND4L-specific effects is technically challenging

  • Endogenous MT-ND4L creates background signals in most cellular systems

  • Species compatibility issues may arise in heterologous systems

• Potential Methodological Solutions:

  • Development of mitochondrially targeted CRISPR systems

  • Cybrid (cytoplasmic hybrid) cell lines incorporating Nyctomys sumichrasti mitochondria

  • Baculovirus expression systems for co-expression of multiple Complex I subunits

  • In vitro translation/transcription systems coupled with reconstitution approaches

Addressing these challenges requires innovative experimental designs and often the integration of multiple complementary approaches to obtain reliable results.

How can polymorphisms in MT-ND4L be investigated for potential associations with reproductive fitness?

Investigating potential associations between MT-ND4L polymorphisms and reproductive fitness requires multidisciplinary approaches that integrate molecular, cellular, and physiological assessments:

• Genetic Association Studies:

  • Sequence MT-ND4L from individuals with different fertility phenotypes

  • Identify single nucleotide polymorphisms (SNPs) and their frequencies

  • Perform statistical analyses to detect associations with fertility parameters

  • Control for population structure and other confounding variables

• Functional Characterization of Variants:

  • Express recombinant variants in appropriate systems

  • Measure Complex I activity, ROS production, and ATP synthesis

  • Assess mitochondrial membrane potential and morphology

  • Evaluate impacts on cellular energy metabolism

• Sperm Function Analysis:

  • Measure sperm motility parameters in relation to MT-ND4L variants

  • Assess mitochondrial function in sperm from different genotypes

  • Evaluate ATP production and energy utilization efficiency

  • Measure oxidative stress markers and mitochondrial DNA integrity

The approach used in human studies, where "Sanger sequencing of the mitochondrial DNA target genes was performed on 68 subfertile and 44 fertile males" , provides a methodological framework that could be adapted for Nyctomys sumichrasti. Though the human study found "lack of statistically significant association between MT-ND3 and MT-ND4L SNPs and male infertility" , species-specific patterns may differ, warranting investigation.

Table 4: Potential SNPs in MT-ND4L for Fertility Association Studies

This integrated approach allows for comprehensive assessment of how MT-ND4L variations might influence reproductive fitness through effects on mitochondrial function.

What emerging technologies show promise for studying the role of Nyctomys sumichrasti MT-ND4L in bioenergetics?

Several cutting-edge technologies are transforming our ability to study the role of proteins like Nyctomys sumichrasti MT-ND4L in mitochondrial bioenergetics:

• Cryo-Electron Tomography:

  • Visualize MT-ND4L in its native mitochondrial environment

  • Achieve near-atomic resolution of Complex I in situ

  • Study dynamic conformational changes during electron transport

  • Map the spatial organization of respiratory complexes

• Single-Molecule Techniques:

  • Track individual Complex I molecules using super-resolution microscopy

  • Measure conformational dynamics with single-molecule FRET

  • Assess electron transfer kinetics at the single-molecule level

  • Capture rare or transient states not detectable in ensemble measurements

• Mitochondrially Targeted CRISPR Systems:

  • Precisely edit mitochondrial DNA to introduce specific MT-ND4L variants

  • Create isogenic cell lines differing only in MT-ND4L sequence

  • Study the effects of mutations in a controlled genetic background

  • Overcome traditional barriers to mitochondrial genome engineering

• Microfluidic Respirometry:

  • Measure oxygen consumption with unprecedented sensitivity

  • Perform high-throughput screening of MT-ND4L variants

  • Analyze real-time responses to environmental perturbations

  • Integrate with other biosensors for multiparameter analysis

• Optogenetic Control of Mitochondrial Function:

  • Use light-sensitive proteins to modulate mitochondrial membrane potential

  • Create temporally precise perturbations of electron transport

  • Study compensatory responses to Complex I dysfunction

  • Investigate tissue-specific consequences of MT-ND4L variations in vivo

These emerging technologies provide unprecedented resolution and control for investigating how MT-ND4L contributes to mitochondrial function, enabling discoveries that were previously inaccessible with conventional techniques.