Recombinant Nymphaea alba Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please specify it in your order; we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
37-322
Protein Length
Full Length of Mature Protein
Species
Nymphaea alba (White water-lily) (Castalia alba)
Target Names
petA
Target Protein Sequence
YPIFAQQSYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPEMKEKMGNLSFQSYRPNKKNILVVGPVPG QKYSEIVFPILSPDPATKKEVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASAAGIVS KIVRKEKKGGYEITISDASNGHETVDIIPPGPELLVSEGEYIKLDQPLTSNPNVGGFGQG DAEIVLQDPLRIQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
Recombinant *Nymphaea alba* Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and what role does it play in photosynthesis?

Apocytochrome f represents the precursor form of cytochrome f before heme attachment. Cytochrome f is a critical component of the cytochrome b6f complex, which facilitates electron transfer between photosystem II and photosystem I during photosynthesis. The mature cytochrome f contains a covalently attached c-type heme group that is essential for its electron transfer function. In Nymphaea alba (white water lily), apocytochrome f is encoded by the chloroplast petA gene and undergoes several maturation steps before becoming functional in the thylakoid membrane .

How does the biosynthetic pathway of cytochrome f progress?

The biosynthesis of cytochrome f is a multistep process that includes:

  • Translation of the petA gene to produce pre-apocytochrome f

  • Targeting to the thylakoid membrane via the signal sequence

  • Processing of the precursor by thylakoid processing peptidase, which cleaves at a consensus site (typically AQA)

  • Covalent attachment of a c-type heme to specific cysteine residues by a heme lyase

  • Proper folding and insertion into the cytochrome b6f complex

Research has demonstrated that heme binding is not a prerequisite for cytochrome f processing, as shown in experiments where the cysteinyl residues responsible for heme ligation were substituted with valine and leucine .

What techniques are recommended for optimal expression of recombinant Nymphaea alba Apocytochrome f?

Expression of recombinant Nymphaea alba Apocytochrome f requires careful consideration of several factors:

Expression SystemAdvantagesLimitationsYield (μg/L culture)
E. coliFast growth, inexpensivePotential misfolding, lack of plant-specific PTMs5-20 (wild type), 30-100 (optimized)
Plant chloroplast transformationNative-like folding environmentComplex methodology, time-consumingVariable (10-50)
Chlamydomonas reinhardtiiModel organism for chloroplast proteinsSpecies differences from Nymphaea15-40

For optimal expression, researchers should consider:

  • Codon optimization for the chosen expression system

  • Use of specialized strains with enhanced machinery for membrane protein expression

  • Careful temperature control during induction (typically 16-18°C)

  • Addition of specific chaperones to assist folding

  • Use of fusion tags (His, MBP, etc.) to facilitate purification

The expression region (amino acids 37-322) should be targeted to avoid inclusion bodies and improve solubility .

How can site-directed mutagenesis be utilized to study the structure-function relationship of Apocytochrome f?

Site-directed mutagenesis represents a powerful tool for investigating structure-function relationships in apocytochrome f. Based on experimental approaches documented for cytochrome f in Chlamydomonas reinhardtii, researchers can design targeted mutations to:

  • Modify the cysteinyl residues involved in heme binding to analyze how heme attachment affects protein processing and function

  • Alter the consensus cleavage site for the thylakoid processing peptidase to study processing kinetics

  • Modify the C-terminal membrane anchor to investigate its role in regulating protein synthesis and stability

  • Introduce changes in key residues involved in electron transfer to analyze their impact on functional efficiency

When designing mutagenesis experiments, researchers should consider:

  • The evolutionary conservation of the targeted residues across species

  • The predicted structural impact of the mutation

  • The potential effects on protein stability and folding

  • The choice of substitution (conservative vs. non-conservative)

Experimental validation should include analysis of protein processing, heme attachment efficiency, complex assembly, and electron transfer rates .

What analytical methods are most effective for assessing the maturation states of Apocytochrome f?

Multiple analytical approaches can be employed to differentiate between the various maturation states of apocytochrome f:

Analytical MethodInformation ProvidedTechnical Considerations
SDS-PAGESeparation of precursor and mature forms based on sizeMay need specialized staining for heme detection
Western blottingSpecific detection of protein forms using antibodiesRequires antibodies against different epitopes
Heme stainingDetection of holocytochrome f (with attached heme)TMBZ or enhanced chemiluminescence methods
Mass spectrometryPrecise molecular weight determination and identification of PTMsRequires careful sample preparation
Spectroscopic analysisAssessment of heme integration and functional stateAbsorbance peaks at specific wavelengths (553 nm for reduced cytochrome f)

To effectively monitor the interplay between protein processing and heme attachment, pulse-chase experiments combined with immunoprecipitation can be employed to track the temporal progression of maturation events. These techniques can reveal whether processing precedes heme attachment or vice versa under various experimental conditions .

How should experiments be designed to investigate the kinetics of pre-apocytochrome f processing?

When investigating the kinetics of pre-apocytochrome f processing, researchers should consider the following experimental design approach:

  • Pulse-chase labeling:

    • Pulse with radioactive amino acids (typically 35S-methionine)

    • Chase with non-radioactive amino acids

    • Sample collection at multiple time points (0, 5, 15, 30, 60, 120 minutes)

  • Subcellular fractionation:

    • Isolation of thylakoid membranes

    • Separation of soluble and membrane-bound fractions

  • Immunoprecipitation with antibodies specific to:

    • N-terminal region (detects both precursor and mature forms)

    • Signal sequence (detects only precursor form)

    • C-terminal region (confirms full-length protein)

  • Analysis by SDS-PAGE and fluorography:

    • Quantification of band intensities

    • Calculation of processing rates

    • Determination of half-life for precursor form

  • Data analysis:

    • First-order kinetics modeling

    • Comparison of processing rates under different conditions

    • Statistical analysis (typically ANOVA with post-hoc tests)

This approach allows researchers to determine the rate-limiting steps in cytochrome f maturation and identify factors that influence processing efficiency .

What are the methodological approaches for comparing Nymphaea alba Apocytochrome f with homologs from other species?

Comparative analysis of apocytochrome f across species provides valuable insights into evolutionary conservation and functional adaptation. Recommended methodological approaches include:

  • Sequence alignment and phylogenetic analysis:

    • Multiple sequence alignment using CLUSTAL, MUSCLE, or T-COFFEE

    • Calculation of sequence identity and similarity percentages

    • Construction of phylogenetic trees using maximum likelihood or Bayesian methods

    • Identification of conserved domains and variable regions

  • Structural comparison:

    • Homology modeling based on crystal structures (e.g., using the soluble form of cytochrome f as template)

    • Superposition of predicted structures

    • Analysis of root-mean-square deviation (RMSD) values

    • Identification of structurally conserved regions

  • Functional characterization:

    • Recombinant expression of homologs under identical conditions

    • Comparative analysis of processing efficiency and heme attachment

    • Measurement of electron transfer rates

    • Assessment of complex assembly capabilities

  • Complementation studies:

    • Expression of Nymphaea alba cytochrome f in mutant strains of other species

    • Evaluation of functional restoration

    • Identification of species-specific factors required for proper function

This multifaceted approach enables researchers to understand the evolutionary constraints on cytochrome f structure and function across different photosynthetic organisms .

What are common challenges in purifying recombinant Nymphaea alba Apocytochrome f and how can they be addressed?

Purification of recombinant apocytochrome f presents several challenges due to its membrane-associated nature and complex maturation process:

ChallengeCauseSolution
Low expression levelsToxicity to host cells, codon biasOptimize codon usage, use specialized expression strains, lower induction temperature
Protein aggregationImproper folding, hydrophobic regionsAdd solubilizing agents, use fusion tags, optimize buffer conditions
Heterogeneous productIncomplete processing, variable heme attachmentPurify different forms separately, optimize expression conditions
Contaminating proteinsNon-specific binding to purification resinsIncrease wash stringency, use multiple purification steps
Loss of structural integrityHarsh purification conditionsUse mild detergents, maintain reducing environment

A recommended purification strategy involves:

  • Cell lysis under gentle conditions (osmotic shock or enzymatic methods)

  • Membrane fractionation by ultracentrifugation

  • Solubilization with appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

  • Affinity chromatography using engineered tags

  • Size exclusion chromatography for final polishing

  • Verification of purity by SDS-PAGE and Western blotting

For storage, maintaining the protein in 50% glycerol in a Tris-based buffer at -20°C is recommended to preserve structural integrity .

How can researchers address data inconsistencies in experiments involving Apocytochrome f membrane insertion?

Data inconsistencies in membrane insertion experiments often arise from several sources. The following systematic approach can help address these issues:

  • Standardize experimental conditions:

    • Maintain consistent pH, temperature, and ionic strength

    • Use the same membrane preparation protocol

    • Control protein:lipid ratios precisely

  • Validate membrane insertion using multiple techniques:

    • Protease protection assays

    • Fluorescence quenching

    • Surface plasmon resonance

    • Sucrose gradient centrifugation

    • Electron microscopy

  • Account for protein heterogeneity:

    • Characterize protein preparations by mass spectrometry

    • Quantify heme content spectrophotometrically

    • Determine processing efficiency by immunoblotting

  • Control for confounding factors:

    • Presence of host cell membrane components

    • Interaction with endogenous proteins

    • Effects of detergents or solubilizing agents

  • Implement statistical robustness:

    • Perform sufficient biological and technical replicates

    • Use appropriate statistical tests

    • Consider Bayesian approaches for data reconciliation

How can Nymphaea alba Apocytochrome f research contribute to the development of artificial photosynthetic systems?

Research on Nymphaea alba Apocytochrome f has significant implications for artificial photosynthesis development:

  • Structural insights:

    • The electron transfer domain structure provides templates for designing synthetic electron carriers

    • Understanding of redox potential determinants can inform the design of optimized electron transport chains

  • Functional adaptations:

    • Mechanisms of efficient electron transfer can be incorporated into biomimetic systems

    • Natural solutions to prevent electron leakage can improve artificial system efficiency

  • Protein engineering applications:

    • Creation of truncated versions with enhanced stability in non-membrane environments

    • Development of fusion proteins combining electron transfer domains with synthetic catalysts

    • Engineering of variants with altered redox potentials for specialized applications

  • Integration into hybrid systems:

    • Incorporation of recombinant cytochrome f into nanostructured electrodes

    • Development of protein-based interfaces between biological and artificial components

    • Creation of self-assembling protein complexes for light energy conversion

These applications could contribute to sustainable energy production systems by leveraging the evolutionary-optimized electron transfer capabilities of cytochrome f .

What are emerging techniques for studying the dynamic aspects of Apocytochrome f folding and heme attachment?

Recent methodological advances provide new opportunities for investigating the dynamic processes involved in apocytochrome f maturation:

  • Time-resolved spectroscopy:

    • Ultrafast transient absorption spectroscopy to monitor conformational changes

    • Resonance Raman spectroscopy to track heme environment changes

    • Circular dichroism spectroscopy to observe secondary structure formation

  • Single-molecule approaches:

    • Fluorescence resonance energy transfer (FRET) to measure intramolecular distances

    • Atomic force microscopy to assess protein unfolding forces

    • Single-molecule tracking to visualize membrane diffusion and complex formation

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for visualizing assembly intermediates

    • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in folding

    • Solid-state NMR to analyze membrane-embedded conformations

  • Computational methods:

    • Molecular dynamics simulations of folding trajectories

    • Quantum mechanical calculations of heme binding energetics

    • Machine learning approaches to predict folding pathways

These emerging techniques can provide unprecedented insights into the temporal sequence and molecular mechanisms of apocytochrome f folding, heme attachment, and membrane insertion, leading to a more comprehensive understanding of cytochrome f biogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.