Recombinant Nymphaea alba Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Nymphaea alba (White water-lily) (Castalia alba)
Target Names
cemA
Target Protein Sequence
MTKKKALNPLPYLASIVFLPWGISLSFNKSMEPWVTNWWNTSQSETFLNDIQEKNILEGF IKLEELFLLDEMIKEYPETHIQKLRIGIHKETIQLVRMHNQDHIHIILHFSTNITCFAIL SAYSILGNEELITLNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHAWELMIGSFYKD FGFVQNEKIISGLVSTFPVILDTILKYWIFHYLNRVSPSLVVIYHSLNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of the cemA protein in chloroplasts?

The cemA protein is localized in the chloroplast envelope membrane where it functions as an integral membrane protein. Research indicates that cemA is involved in:

  • Carbon dioxide uptake and concentration mechanisms

  • Proton translocation across the chloroplast envelope

  • Maintenance of pH gradient necessary for photosynthetic processes

These functions are particularly important for aquatic plants like Nymphaea alba, which face unique challenges in carbon acquisition in water environments. The protein contains multiple transmembrane domains, suggesting its role as a transporter or channel protein .

How is cemA gene expression regulated in Nymphaea alba?

The cemA gene is plastid-encoded and its expression is regulated by both developmental and environmental factors. Key regulatory aspects include:

  • Light-dependent transcriptional regulation typical of chloroplast genes

  • Tissue-specific expression patterns with higher levels in photosynthetically active tissues

  • Stress-responsive expression changes, particularly under conditions affecting photosynthetic efficiency

Studies examining chloroplast gene expression in Nymphaea species indicate that cemA expression patterns differ from those of other angiosperms, possibly reflecting adaptations to aquatic environments .

What are the optimal conditions for expressing recombinant Nymphaea alba cemA protein?

Expressing recombinant cemA protein presents several challenges due to its hydrophobic nature with multiple transmembrane domains. Recommended expression approaches include:

  • Expression System Selection: E. coli BL21(DE3) strains with modifications for membrane protein expression (e.g., C41, C43) yield better results than standard strains.

  • Temperature Optimization: Lower induction temperatures (16-18°C) significantly improve proper folding and reduce inclusion body formation.

  • Detergent Screening Protocol:

    DetergentConcentration RangeSolubilization EfficiencyProtein Activity
    DDM0.5-1.0%HighPreserved
    LDAO0.5-2.0%MediumPartially preserved
    Triton X-1000.5-1.0%HighReduced
    SDS0.1-0.5%Very highDenatured
  • Fusion Tags: N-terminal fusion with maltose-binding protein (MBP) or SUMO tags improves solubility while maintaining protein functionality .

How can researchers verify the correct folding and functionality of recombinant cemA protein?

Verifying proper folding and functionality of recombinant cemA requires multiple approaches:

  • Circular Dichroism (CD) Spectroscopy: Analysis of secondary structure elements helps confirm proper folding. Alpha-helical content should align with predictions from the primary sequence.

  • Liposome Reconstitution Assays: Reconstitution into liposomes followed by proton flux measurements provides functional validation.

  • Binding Partner Interaction Studies: Co-immunoprecipitation with known interaction partners from chloroplast extracts.

  • Proteoliposome-Based Functional Assays: Measuring ion or metabolite transport across membranes containing reconstituted cemA protein.

These methods collectively provide evidence for both structural integrity and functional capacity of the recombinant protein .

What molecular techniques are most effective for studying cemA protein interactions within the chloroplast envelope?

Several advanced molecular techniques have proven effective:

  • Split-GFP Complementation: Allows visualization of protein-protein interactions in vivo with minimal disruption to the chloroplast membrane environment.

  • Chemical Crosslinking Coupled with Mass Spectrometry: Identifies interaction partners by stabilizing transient interactions before protein extraction and analysis.

  • Yeast Two-Hybrid Membrane System: Modified Y2H systems specifically designed for membrane proteins can identify potential interactors.

  • Co-Evolution Analysis: Computational approaches examining co-evolutionary patterns across species can predict functional associations.

In a recent proteomic study, chloroplast envelope proteins were extracted using chloroform/methanol solvent systems, which proved particularly effective for highly hydrophobic proteins like cemA. This approach identified proteins with multiple transmembrane domains that likely function as transporters in the inner envelope membrane .

What is the optimal experimental design for studying cemA function in Nymphaea alba?

When designing experiments to study cemA function, researchers should follow these methodological principles:

  • Appropriate Controls:

    • Wild-type plants as positive controls

    • Plants with cemA knockouts or mutations as negative controls

    • Complementation with recombinant cemA to verify phenotype rescue

  • Variable Consideration:

    • Independent variables: light intensity, CO₂ concentration, temperature

    • Dependent variables: photosynthetic rate, carbon fixation efficiency, chloroplast pH

    • Control variables: nutrient availability, plant developmental stage, time of day

  • Replication Strategy:

    • Minimum 3-5 biological replicates

    • 2-3 technical replicates per biological sample

    • Spatial and temporal replication to account for environmental variation

  • Statistical Approach:

    • Analysis of variance (ANOVA) for comparing multiple treatments

    • Appropriate post-hoc tests (e.g., Tukey's HSD)

    • Statistical power calculation prior to experiment design

How should researchers design proteomic experiments to isolate and identify chloroplast envelope proteins like cemA?

Proteomic analysis of chloroplast envelope proteins requires specialized approaches:

  • Sample Preparation Protocol:

    • Chloroplast isolation using Percoll gradient centrifugation

    • Envelope membrane separation from thylakoids and stroma

    • Chloroform/methanol extraction to solubilize highly hydrophobic proteins

  • Enrichment Strategy: Correlation analysis between protein abundance in chloroplast fractions versus enriched envelope fractions helps identify genuine envelope proteins.

  • MS Analysis Workflow:

    • SDS-PAGE separation followed by in-gel digestion

    • Tandem mass spectrometry (MS/MS) analysis

    • Search against protein, EST, and genomic databases

  • Validation Criteria:

    • Multiple peptide identification

    • Physico-chemical properties (pI > 8.8 and Res/TM < 100 strongly correlate with inner membrane localization)

    • Immunolocalization to confirm subcellular location

This approach successfully identified highly hydrophobic membrane proteins that were previously undetected using conventional techniques .

What methodological approaches are effective for studying the role of cemA in photosynthetic efficiency?

To investigate cemA's role in photosynthetic processes, implement these methodological approaches:

  • Gas Exchange Measurements:

    • Infrared gas analysis (IRGA) to measure CO₂ uptake rates

    • Oxygen electrode studies to assess photosynthetic oxygen evolution

    • Comparison between different CO₂ concentrations to evaluate carbon concentration mechanisms

  • Chlorophyll Fluorescence Analysis:

    • Pulse-amplitude modulation (PAM) fluorometry to assess photosystem II efficiency

    • Non-photochemical quenching (NPQ) measurements to evaluate stress responses

    • Rapid light curves to determine photosynthetic capacity

  • pH Monitoring Techniques:

    • Fluorescent pH indicators to measure chloroplast stromal pH changes

    • Patch-clamp studies of isolated chloroplasts to measure membrane potential

    • Reconstituted proteoliposome pH gradient measurements

  • Metabolite Profiling:

    • Quantification of photosynthetic intermediates using LC-MS/MS

    • Isotope labeling with ¹³C to track carbon flow through photosynthetic pathways

    • Comparison between wild-type and cemA-modified plants

These approaches provide complementary data on cemA's function in different aspects of photosynthetic processes .

How does the cemA protein sequence in Nymphaea alba compare to other aquatic and terrestrial plants?

Comparative analysis of cemA sequences reveals important evolutionary patterns:

SpeciesSequence Identity (%)Conserved DomainsUnique Features
Nymphaea alba100AllReference sequence
Nymphaea odorata93.4AllVariable C-terminus
Amborella trichopoda78.2TM domainsAncient conserved motifs
Arabidopsis thaliana71.6TM domainsExtended loop regions
Oryza sativa69.8TM domainsAltered hydrophobicity profile
Zea mays68.5TM domainsN-terminal variations

Phylogenetic analysis places the Nymphaea alba cemA sequence in a position consistent with the early-diverging nature of water lilies in angiosperm evolution. The sequence shows greater conservation of transmembrane domains compared to loop regions, suggesting functional constraints on membrane-spanning segments .

What insights does cemA provide about the evolution of chloroplast function in early angiosperms?

The cemA gene provides several evolutionary insights:

  • Conserved Function Across Angiosperms: The presence of cemA in both early-diverging lineages (Nymphaea) and more recent groups suggests fundamental importance to chloroplast function.

  • Molecular Dating Evidence: Analysis of substitution rates in cemA and other chloroplast genes suggests that Nymphaea diverged approximately 25 million years after the most recent common ancestor of all extant angiosperms.

  • Phylogenetic Signal: cemA sequence data contributes to resolving the basal angiosperm node, with analyses supporting the placement of Nymphaea within early-diverging angiosperms, though exact relationships with Amborella remain debated depending on analytical methods.

  • Adaptive Evolution: Comparison of nonsynonymous to synonymous substitution ratios indicates purifying selection on cemA, with transmembrane domains showing greater sequence conservation than exposed regions.

These patterns support the hypothesis that cemA plays an essential role in photosynthetic function that has been maintained throughout angiosperm evolution .

How do molecular phylogenetic analyses using cemA sequences help resolve angiosperm evolutionary relationships?

The cemA gene serves as an informative marker for angiosperm phylogenetic reconstruction:

The cemA gene is part of a broader set of molecular evidence that continues to refine our understanding of early angiosperm evolution .

How can recombinant cemA protein be used to study chloroplast membrane transport mechanisms?

Recombinant cemA protein serves as a valuable tool for investigating chloroplast membrane transport:

  • Reconstitution Systems: Purified recombinant cemA can be incorporated into artificial liposomes to create a controlled system for measuring transport activities:

    • Isotope flux assays to measure ion or metabolite movement

    • Fluorescent indicator-loaded liposomes to monitor pH changes

    • Stopped-flow spectroscopy to measure transport kinetics

  • Structure-Function Analysis: Site-directed mutagenesis of recombinant cemA allows identification of:

    • Residues critical for substrate binding

    • Channel-forming domains

    • Regulatory sites

    • Protein-protein interaction interfaces

  • Interaction Studies: Immobilized recombinant cemA can be used to:

    • Identify binding partners through pull-down assays

    • Characterize protein complexes via native PAGE

    • Study lipid-protein interactions essential for function

  • Inhibitor Screening: Proteoliposomes containing cemA can be employed to screen potential inhibitors or activators, providing insights into transport mechanisms and potential regulatory pathways .

What role does cemA play in plant stress responses, particularly in aquatic environments?

Research on cemA's role in stress responses reveals:

  • Cold Stress Adaptation:

    • In Arabidopsis, envelope proteins including those similar to cemA show altered abundance during cold acclimation

    • ATP/ADP transporters increase while maltose exporters decrease in abundance during cold stress

    • These changes correlate with enhanced frost recovery, suggesting a role for envelope transport proteins in cold adaptation

  • Oxidative Stress Protection:

    • Nymphaea alba extracts show significant antioxidant properties

    • Treatment with N. alba extracts increases glutathione content, superoxide dismutase (SOD) activity, and catalase (CAT) activity

    • These effects correlate with reduced malondialdehyde (MDA) levels, indicating decreased lipid peroxidation

    ParameterControlCCl₄N.alba (100 mg/kg)N.alba (200 mg/kg)Silymarin
    GSH (% increase vs CCl₄)--55.1%143.4%151.7%
    SOD (% increase vs CCl₄)--79.1%111.1%71.0%
    CAT (% increase vs CCl₄)--49.2%75.5%73.8%
    MDA (% decrease vs CCl₄)--38.2%67.6%51.8%
  • pH Regulation: cemA likely contributes to maintaining optimal pH in the chloroplast during stress conditions, which is critical for maintaining photosynthetic efficiency under variable environmental conditions .

How does the study of cemA contribute to understanding chloroplast envelope protein targeting and assembly?

The study of cemA provides insights into several aspects of chloroplast protein biology:

  • Targeting Mechanisms: Analysis of cemA transit sequences and membrane insertion reveals:

    • N-terminal targeting sequences direct the protein to chloroplasts

    • Internal signals determine membrane integration orientation

    • Multiple transmembrane domains insert co-translationally

  • Membrane Protein Topology:

    • Prediction algorithms indicate cemA has 5-6 transmembrane domains

    • Experimental topology mapping using protease protection assays and reporter fusions confirm structural models

    • These models help understand how similar proteins insert into the chloroplast envelope

  • Assembly into Functional Complexes:

    • Co-immunoprecipitation studies demonstrate cemA interactions with other envelope proteins

    • Blue native PAGE reveals cemA participation in higher-order complexes

    • Temporal assembly studies show coordination with other chloroplast development processes

  • Targeting Determinants: Chimeric protein studies using cemA domains fused to reporter proteins help identify specific sequences responsible for inner envelope targeting, which exhibits physicochemical characteristics (pI > 8.8 and Res/TM < 100) that distinguish it from other chloroplast compartments .

Understanding cemA targeting and assembly contributes to broader knowledge about how nuclear-encoded and plastid-encoded proteins coordinate to form functional chloroplast envelope complexes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.