Recombinant Nymphaea alba Cytochrome b559 subunit alpha (psbE)

Shipped with Ice Packs
In Stock

Description

General Overview of psbE (Cytochrome b559 Subunit Alpha)

psbE encodes the α-subunit of Cytochrome b559, a heterodimeric protein (α:psbE; β:psbF) essential for Photosystem II (PSII) assembly and photoprotection in oxygenic photosynthetic organisms . Key characteristics include:

  • Structural Features:

    • Consists of 84–83 amino acids (depending on species) .

    • Contains a transmembrane domain and a lumenal domain in the α-subunit .

    • Coordinates a heme cofactor via conserved histidine residues (His-22 in α-subunit) .

  • Functional Roles:

    • Critical for PSII assembly, particularly in stabilizing the D2 module during early biogenesis .

    • Participates in secondary electron transport pathways to mitigate photodamage .

    • Exists in redox forms with varying potentials (VLP, LP, IP, HP), influencing PSII activity .

Recombinant psbE Production in Model Organisms

While Nymphaea alba psbE remains unstudied, recombinant psbE has been produced in other species for structural and functional analyses:

OrganismExpression SystemTagPurityKey ApplicationsSource
SynechocystisE. coliHis>90%Mutagenesis, PSII assembly studies
ChaetosphaeridiumE. coliHis>90%Structural analysis, redox studies
Cyanidium caldariumE. coliHis>90%Functional assays, protein interactions

Notes:

  • His-tagged recombinant psbE is widely used for affinity purification and structural studies .

  • Mutagenesis in Synechocystis revealed that disrupted heme coordination destabilizes PSII, requiring gene amplification for functional recovery .

Limitations in Nymphaea alba-Specific Research

A search of peer-reviewed literature and commercial databases (e.g., Cusabio, Creative Biomart) reveals no records of recombinant psbE from Nymphaea alba. The only Nymphaea alba recombinant protein documented is psbJ (Photosystem II reaction center protein J), unrelated to Cytochrome b559 .

Potential Reasons for the Gap:

  • Research Priorities: Nymphaea alba is less commonly used in photosynthesis studies compared to model organisms like Synechocystis or Chlamydomonas .

  • Technical Challenges: Low homology or instability of Nymphaea alba psbE in heterologous systems may hinder recombinant production.

  • Commercial Focus: Recombinant psbE is prioritized in species with established genetic tools (e.g., cyanobacteria, algae) .

Future Directions for Nymphaea alba psbE Research

To advance studies on Nymphaea alba psbE, the following steps are recommended:

  1. Genomic Sequencing: Identify the psbE gene in Nymphaea alba using transcriptomic or genomic databases.

  2. Heterologous Expression: Test E. coli or Pichia systems for psbE production, optimizing codon usage and solubility.

  3. Functional Characterization: Analyze redox properties, heme coordination, and interactions with PSII subunits (e.g., D2, PsbF).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
psbE; Cytochrome b559 subunit alpha; PSII reaction center subunit V
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-83
Protein Length
Full Length of Mature Protein
Species
Nymphaea alba (White water-lily) (Castalia alba)
Target Names
psbE
Target Protein Sequence
SGSTGERAFADIITSIRYWVIHSITIPSLFIAGWSFVSTGLAYDVFGSPRPNEYFTESRQ GIPLITGRFDSLEQLDEFSRSF
Uniprot No.

Target Background

Function
This b-type cytochrome is tightly associated with the reaction center of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into a charge separation.
Protein Families
PsbE/PsbF family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.