Recombinant Nymphaea alba Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

General Information

Nymphaea alba, also known as the white water-lily, is a plant species that contains the cytochrome b6-f complex . The petD subunit, with a molecular weight of approximately 17 kDa, plays a crucial role in the catalytic activity of the cytochrome b6-f complex .

Recombinant petD is produced using genetic engineering techniques, where the gene encoding the petD subunit from Nymphaea alba is expressed in a host organism like E. coli or yeast . The recombinant protein can then be isolated and used for various research purposes .

Table 1: Properties of Recombinant Nymphaea alba Cytochrome b6-f Complex Subunit 4 (petD)

PropertyDescription
Product OverviewRecombinant Full Length Nymphaea alba Cytochrome b6-f complex subunit 4(petD) Protein (Q6EW21) (1-170aa), fused to N-terminal His tag, was expressed in E. coli
Alternative Names17 kDa polypeptide
SourceYeast
Purity>85% (SDS-PAGE)
UniProt No.Q6EW21
Storage ConditionsLiquid form: 6 months at -20°C/-80°C. Lyophilized form: 12 months at -20°C/-80°C
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C .

Biological Function

The cytochrome b6-f complex mediates the transfer of electrons between Photosystem II and Photosystem I, which is essential for photosynthesis . It also transfers protons from the chloroplast stroma across the thylakoid membrane into the lumen, creating a proton gradient that drives ATP synthesis .

The petD subunit is critical for the complex's catalytic activity. Studies involving trypsinolysis have demonstrated that digestion of subunit IV (petD) leads to a decrease in electron transfer activity and proton translocation .

The cytochrome b6-f complex also plays a role in cyclic photophosphorylation, which helps maintain the ATP/NADPH ratio necessary for carbon fixation .

Reaction Mechanism

The cytochrome b6-f complex facilitates both non-cyclic and cyclic electron transfer between plastoquinol (QH2) and plastocyanin (Pc) :

  1. Non-cyclic electron transfer:

    H2O → Photosystem II → QH2 → Cytochrome b6f → Pc → Photosystem I → NADPH

  2. Cyclic electron transfer:

    QH2 → Cytochrome b6f → Pc → Photosystem I → Q

The complex catalyzes the transfer of electrons from plastoquinol to plastocyanin while pumping protons across the thylakoid membrane :

$$ QH_2 + 2Pc(Cu^{2+}) + 2H^+{stroma} \rightarrow Q + 2Pc(Cu^+) + 4H^+{lumen} $$

This reaction occurs via the Q cycle, where plastoquinol transfers its electrons to high- and low-potential electron transport chains .

Research Findings

Trypsinolysis experiments have shown the importance of subunit IV (petD) in the cytochrome b6-f complex . The activity of the complex decreases with increased trypsin incubation time, resulting in a maximal inactivation of 80% after 7 minutes . This inactivation is accompanied by the destruction of proton translocation activity .

The digestion of subunit IV by trypsin correlates with the decrease in electron transfer activity, with a molecular mass of approximately 14 kDa for the cleaved subunit IV, suggesting a cleavage site at lysine 119 or arginine 125 or 126 .

When thylakoid membranes are assayed for cytochrome b6-f complex activity, very little activity is observed, and the activity is not sensitive to trypsinolysis until sonication is performed . After sonication, activity and sensitivity to trypsinolysis greatly increase, suggesting that subunit IV protrudes from the lumen side of the membrane .

Related Products

Several related products are available for studying the cytochrome b6-f complex and its subunits :

  • Recombinant Nymphaea alba ATP synthase subunit c, chloroplastic (atpH)

  • Recombinant Nymphaea alba Photosystem I assembly protein Ycf4 (ycf4)

  • Recombinant Nymphaea alba Photosystem II reaction center protein H (psbH)

  • Recombinant Nymphaea alba Cytochrome b559 subunit alpha (psbE)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Nymphaea alba (White water-lily) (Castalia alba)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLFQIQIDLEILR
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the genetic organization of petD in Nymphaea alba compare to other water lily species?

The petD gene in Nymphaea alba shows evidence of sequence conservation with other water lily species but contains specific polymorphisms that can be used for species identification. Molecular analysis techniques similar to those used in hybrid identification (like those applied to N. alba var. rubra) can detect these differences . When comparing chloroplast markers like trnK intron, matK, and rbcL gene sequences, researchers can identify species-specific polymorphic nucleotide sites that differentiate Nymphaea alba from closely related species such as N. odorata. These genetic differences can manifest in the protein structure and potentially affect the function of the cytochrome b6-f complex .

What expression systems are most effective for producing recombinant Nymphaea alba petD protein?

For expression of recombinant Nymphaea alba petD, bacterial expression systems like E. coli typically yield insufficient results due to the membrane-associated nature of the protein. More successful approaches include:

  • Tobacco-based transient expression systems: Using Agrobacterium-mediated transformation of Nicotiana tabacum (tobacco) leaves, which provides the appropriate thylakoid membrane environment for proper folding and insertion .

  • Algal expression systems: Chlamydomonas reinhardtii can be particularly effective as it provides the native photosynthetic cellular machinery.

  • Cell-free expression systems: Combined with artificial membrane scaffolds, these can be optimized for membrane protein production.

When working with recombinant petD protein, it's essential to include thylakoid targeting sequences to ensure proper localization, as Western blot analysis of total cell extracts will not detect the protein without proper membrane fractionation .

What are the most reliable methods for isolating and purifying recombinant Nymphaea alba petD protein?

Purification of recombinant Nymphaea alba petD requires specialized techniques due to its membrane-associated nature:

  • Thylakoid membrane isolation: Begin with differential centrifugation of leaf or chloroplast preparations to isolate thylakoid membrane fractions .

  • Detergent solubilization: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin to solubilize membrane proteins while maintaining protein integrity.

  • Affinity chromatography: If the recombinant protein includes an affinity tag (His, FLAG, etc.), use appropriate affinity resins.

  • Size exclusion chromatography: Apply as a final polishing step to separate intact cytochrome b6-f complex from individual components.

Important considerations include maintaining low temperatures (0-4°C) throughout the procedure, including protease inhibitors to prevent degradation, and avoiding harsh detergents that might disrupt protein-protein interactions within the complex .

How can researchers effectively validate antibody specificity for Nymphaea alba petD in Western blot analysis?

To validate antibody specificity for Nymphaea alba petD in Western blotting:

  • Use proper sample preparation: Isolate thylakoid membrane fractions rather than total cell extracts, as membrane-associated proteins like petD will not be detected in whole-cell preparations .

  • Include appropriate controls:

    • Positive control: Purified recombinant petD protein or thylakoid preparations from wild-type Nymphaea alba

    • Negative control: Thylakoid preparations from petD knockout/knockdown systems if available

    • Cross-reactivity control: Thylakoid preparations from related species to assess specificity

  • Optimize detection conditions:

    • Use recommended antibody dilutions (typically 1:1000 for primary antibodies)

    • Ensure appropriate blocking to reduce background

    • Consider enhanced chemiluminescence (ECL) detection for optimal sensitivity

  • Confirm expected molecular weight: The apparent molecular weight may differ from calculated weight due to post-translational modifications or processing of N-terminal or C-terminal regions .

What molecular cloning strategies are most effective for isolating and manipulating the petD gene from Nymphaea alba?

For effective molecular cloning of Nymphaea alba petD:

  • Initial gene amplification: Design primers based on conserved regions of the petD gene from related species. Use PCR with high-fidelity polymerases to amplify the target sequence from Nymphaea alba genomic DNA or cDNA.

  • Cloning vector selection:

    • For sequence verification: Use vectors like pJET1.2 (as used for ITS regions in Nymphaea studies)

    • For expression: Select vectors with appropriate promoters for the intended expression system

  • Sequence verification: Perform bidirectional sequencing using both gene-specific and vector-specific primers to ensure sequence accuracy. Screen multiple clones (20+ clones) to account for potential PCR-introduced errors, similar to the approach used for ITS region analysis in Nymphaea studies .

  • Site-directed mutagenesis: For functional studies, introduce specific mutations to examine structure-function relationships.

  • Incorporation of tags: Consider adding epitope tags or fusion partners to facilitate detection and purification, but note that N-terminal tags may interfere with thylakoid targeting signals.

How does petD sequence variation in Nymphaea alba hybrids impact electron transport efficiency?

Sequence variation in petD among Nymphaea alba hybrids can significantly impact electron transport efficiency through several mechanisms:

Research shows that genetic recombination between parental alleles, as observed in hybrids through molecular cloning and sequencing techniques, can introduce novel genetic combinations that affect protein function . The resulting phenotypic effects may include altered photosynthetic efficiency, stress tolerance, or growth characteristics.

What techniques are most effective for studying protein-protein interactions between petD and other subunits of the cytochrome b6-f complex?

Several advanced techniques can effectively study protein-protein interactions involving petD:

  • Co-immunoprecipitation (Co-IP): Using antibodies specific to petD or other subunits to pull down interaction partners. This requires effective antibodies like those developed for related subunits such as PetL .

  • Bimolecular Fluorescence Complementation (BiFC): By fusing complementary fragments of fluorescent proteins to potential interaction partners, researchers can visualize interactions in vivo.

  • Cryo-electron microscopy: Provides structural information about the assembled complex at near-atomic resolution, revealing interaction interfaces.

  • Cross-linking mass spectrometry: Chemical cross-linkers can capture transient interactions, and subsequent mass spectrometry analysis can identify the interacting regions.

  • Yeast two-hybrid with membrane adaptations: Modified Y2H systems designed for membrane proteins can screen for binary interactions.

  • Förster Resonance Energy Transfer (FRET): When combined with confocal microscopy, FRET can detect protein proximity in living cells.

For all these techniques, proper controls are essential, including non-interacting protein pairs and known interaction partners to validate experimental conditions.

How can researchers differentiate between native and recombinant petD proteins in experimental systems?

Differentiating between native and recombinant petD requires strategic experimental design:

  • Epitope tagging: Incorporate small epitope tags (FLAG, HA, or His) into the recombinant protein that can be specifically detected without affecting function.

  • Species-specific antibodies: Develop antibodies that recognize species-specific epitopes present in Nymphaea alba petD but absent in the host expression system.

  • Mass spectrometry detection: Use peptide mass fingerprinting to identify species-specific peptides that differentiate between native and recombinant proteins.

  • Expression in heterologous systems: Use expression systems that lack endogenous petD or have significantly different petD sequences, such as bacterial or yeast systems for plant proteins.

  • Genetic knockdown/knockout with complementation: In model systems, knock out the endogenous gene and complement with the tagged recombinant version.

When using Western blot detection, it's critical to use thylakoid membrane fractions rather than total cell extracts, as membrane proteins like petD will not be detected in whole-cell preparations without proper fractionation .

What are common pitfalls in detecting petD protein expression and how can they be overcome?

Common challenges in detecting petD protein expression include:

  • Improper sample preparation:

    • Problem: No bands observed in Western blot from total cell extracts

    • Solution: Use thylakoid membrane fractions instead, as recommended for similar cytochrome b6-f complex subunits

  • Protein degradation:

    • Problem: Multiple bands or smears below expected molecular weight

    • Solution: Include protease inhibitors in all buffers, maintain samples at 4°C, and minimize freeze-thaw cycles

  • Low expression levels:

    • Problem: Weak or undetectable signals

    • Solution: Optimize codon usage for expression system, use stronger promoters, or concentrate samples through membrane enrichment techniques

  • Antibody cross-reactivity:

    • Problem: Multiple non-specific bands

    • Solution: Use antigen-affinity purified antibodies similar to those developed for related subunits , and optimize blocking conditions

  • Protein folding issues:

    • Problem: Aggregation or inclusion body formation

    • Solution: Express in photosynthetic organisms that provide the necessary chaperones and insertion machinery for thylakoid membrane proteins

For optimal results, researchers should consider using dilutions of approximately 1:1000 for primary antibodies when performing Western blot analysis, similar to the recommendations for related cytochrome b6-f complex subunits .

How can researchers resolve inconsistencies between genetic and proteomic data in petD studies?

When facing discrepancies between genetic and proteomic data:

  • Confirm sequence accuracy: Re-sequence clones to verify genetic data, as post-transcriptional modifications can introduce variations. Consider sequencing multiple clones as done in hybrid analysis studies .

  • Check for alternative splicing: Perform RT-PCR with primers spanning potential splice junctions to identify transcript variants.

  • Evaluate post-translational modifications: Use mass spectrometry to identify modifications that affect protein mobility or detection.

  • Assess protein stability: Perform pulse-chase experiments to determine if the protein undergoes rapid turnover.

  • Examine transcriptional vs. translational regulation: Compare mRNA levels (qRT-PCR) with protein levels (Western blot) to identify regulatory disconnects.

  • Consider hybrid effects: In Nymphaea hybrids, genetic recombination between parental alleles can create novel protein variants with unexpected properties, similar to what has been observed in other subunits of photosynthetic complexes in hybrid species .

  • Validate antibody specificity: Confirm antibody specificity through knockout controls or competitive binding assays.

How might CRISPR-Cas9 gene editing be applied to study petD function in Nymphaea alba?

CRISPR-Cas9 offers several strategic approaches for studying petD in Nymphaea alba:

Implementation challenges include transformation efficiency in aquatic plants, potential off-target effects, and chimeric tissue formation. Researchers should develop tissue-specific protocols and validation methods similar to those used in molecular cloning techniques for Nymphaea species .

What are the implications of petD sequence conservation across Nymphaea species for evolutionary studies of aquatic plants?

The conservation patterns of petD across Nymphaea species provide valuable insights for evolutionary studies:

  • Phylogenetic markers: petD sequence variations can serve as molecular markers for resolving evolutionary relationships among Nymphaea species, complementing other markers like ITS, trnK intron, matK, and rbcL that have been used successfully in water lily classification .

  • Selection pressure analysis: By examining dN/dS ratios (ratio of non-synonymous to synonymous substitutions), researchers can identify regions under purifying selection, indicating functional importance.

  • Hybridization events: As demonstrated in studies of Nymphaea alba var. rubra, molecular analysis of cytochrome complex genes can help identify historical hybridization events and parental species contributions .

  • Adaptation signatures: Comparative analysis may reveal adaptive changes in petD associated with different aquatic environments.

  • Co-evolution patterns: Comparing evolutionary rates with other subunits of the cytochrome b6-f complex can reveal co-evolutionary patterns and functional constraints.

Research has shown that combining nuclear markers (like ITS) with chloroplast markers provides a comprehensive picture of evolutionary history, as demonstrated in hybrid identification studies .

How can comparative studies between recombinant petD from different Nymphaea species inform photosynthetic adaptation research?

Comparative studies of recombinant petD from different Nymphaea species can provide significant insights into photosynthetic adaptations:

  • Functional variation: By expressing recombinant petD variants from different species in a common background, researchers can directly compare their effects on:

    • Electron transport rates

    • Complex stability under various stress conditions

    • Interaction efficiency with partner proteins

  • Structure-function relationships: Site-directed mutagenesis of species-specific amino acid residues can pinpoint the molecular basis for functional differences.

  • Habitat adaptation signatures: Correlating sequence variations with native habitat conditions (temperature ranges, light intensity, water chemistry) can reveal adaptive molecular evolution.

  • Hybrid performance prediction: Understanding how different petD alleles function can help predict the photosynthetic performance of natural and artificial hybrids, similar to molecular approaches used to characterize Nymphaea alba var. rubra as a hybrid .

  • Evolutionary constraint mapping: Regions with high conservation across diverse species likely represent functionally critical domains that cannot tolerate variation.

Such studies require careful experimental design, including:

  • Expression in systems that allow proper membrane insertion

  • Functional assays that measure specific aspects of electron transport

  • Structural analysis techniques to correlate sequence with conformation

  • Assessment of protein-protein interactions with partner subunits

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.