Recombinant Nymphaea alba Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

ParameterDetails
Expression SystemEscherichia coli or yeast-based systems
TagVariable (determined during production; commonly His-tagged)
Purity>85% (verified by SDS-PAGE)
Storage-20°C in Tris-based buffer with 50% glycerol; avoid freeze-thaw cycles

Key Steps:

  1. Cloning: Full-length petB gene insertion into expression vectors.

  2. Induction: IPTG or similar agents for protein overexpression.

  3. Purification: Affinity chromatography (e.g., Ni-NTA for His-tagged variants) .

Functional Role in Photosynthesis

  • Electron Transport: Facilitates plastoquinol oxidation and plastocyanin reduction, critical for ATP synthesis .

  • Complex Assembly: Interacts with subunits PetD (cytochrome b6/f subunit IV), PetG, and PetN to stabilize the cytochrome b6/f dimer .

  • Redox Regulation: Participates in cyclic electron transfer (CET) and redox sensing .

Research Applications

Experimental Uses:

  • ELISA: Quantification of cytochrome b6 levels in photosynthetic studies .

  • Structural Biology: Crystallization trials to resolve membrane protein architectures .

  • Mutagenesis Studies: Investigating residues critical for electron bifurcation (Q-cycle) .

Recent Findings:

  • Stability Mutants: Deletion of low-molecular-weight subunits (e.g., PetL) reduces dimeric cytochrome b6/f complex stability by 50% .

  • Co-Translational Insertion: CSP41 RNA-binding protein stabilizes petB transcripts during membrane integration .

Challenges and Future Directions

  • Thermostability: Instability at >4°C limits in vitro applications .

  • Heterologous Expression: Low yields in non-native systems (e.g., E. coli) .

  • Functional Studies: Requires reconstitution with thylakoid lipids for accurate activity assays .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, and additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Nymphaea alba (White water-lily) (Castalia alba)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFHCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIVGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFSMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex. This complex plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitating cyclic electron flow around PSI, and regulating state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of cytochrome b6 in photosynthetic organisms?

Cytochrome b6 is one of the four large subunits of the cytochrome b6f complex that plays pivotal roles in both linear and cyclic electron transport of oxygenic photosynthesis in plants and cyanobacteria. The protein contains multiple heme groups (bL, bH, and ci-heme) that are essential for its electron transfer function. The cytochrome b6f complex serves as an electron carrier between photosystem II and photosystem I, coupling electron transfer to proton translocation across the thylakoid membrane. This proton gradient is subsequently used for ATP synthesis.

The full-length cytochrome b6 protein typically consists of approximately 215 amino acids, as seen in the Populus alba sequence, forming transmembrane helices that anchor the protein within the thylakoid membrane. The protein contains conserved histidine residues that serve as axial ligands for the b-hemes, and a unique cysteine residue that forms a covalent bond with the ci-heme .

How does recombinant cytochrome b6 differ from native protein in terms of structural properties?

Recombinant cytochrome b6 proteins are generally expressed with affinity tags, such as His-tags, to facilitate purification. These tags may affect protein folding, stability, or interaction with other components. When expressed in heterologous systems like E. coli, recombinant cytochrome b6 may lack post-translational modifications or proper heme incorporation that would normally occur in the native chloroplast environment.

Studies have shown that the absence of proper heme binding in recombinant systems can result in structural changes to cytochrome b6. For example, mutations affecting the cysteine ligand of the ci-heme (such as in the petB-C35V mutant) result in proteins with altered electrophoretic mobility and no peroxidase activity . Researchers must consider these potential differences when designing experiments with recombinant proteins.

What expression systems are most effective for producing functional recombinant cytochrome b6?

Several expression systems have been used to produce recombinant cytochrome b6, including E. coli, yeast, baculovirus, and mammalian cells . E. coli is commonly used due to its ease of manipulation, rapid growth, and high protein yields. For example, recombinant Populus alba cytochrome b6 has been successfully expressed in E. coli with an N-terminal His tag .

What are the optimal conditions for expression and purification of recombinant cytochrome b6 with proper heme incorporation?

Successful expression of functional cytochrome b6 requires careful optimization of growth conditions and supplementation with heme precursors. When using E. coli as an expression system, researchers should consider:

  • Using specialized E. coli strains with enhanced capacity for membrane protein expression and heme biosynthesis

  • Supplementing growth media with δ-aminolevulinic acid (ALA), a heme precursor

  • Inducing protein expression at lower temperatures (16-25°C) to allow proper folding

  • Extending the induction period to allow sufficient time for heme incorporation

For purification, a multi-step approach is typically necessary:

  • Initial membrane solubilization using mild detergents (e.g., n-dodecyl-β-D-maltoside)

  • Metal affinity chromatography using the N-terminal His tag

  • Size exclusion chromatography to separate properly assembled complexes

  • Verification of heme incorporation through spectroscopic analysis

Researchers should note that proper reconstitution of the full cytochrome b6f complex requires co-expression or reconstitution with other subunits, as the assembly is a coordinated process involving multiple protein-protein interactions and heme binding events .

How can researchers assess the functional integrity of recombinant cytochrome b6 proteins?

Several complementary approaches can be used to evaluate the functional integrity of recombinant cytochrome b6:

  • Spectroscopic analysis: UV-visible absorption spectroscopy can confirm proper heme incorporation through characteristic absorption peaks. The reduced and oxidized forms of cytochrome b6 have distinct spectral signatures.

  • Peroxidase activity assay: Native cytochrome b6 with properly incorporated ci-heme exhibits peroxidase activity, which can be measured using standard substrates. The petB-C35V mutant and ccb mutants lacking ci-heme show no peroxidase activity .

  • Electron transfer assays: In vitro assays using artificial electron donors and acceptors can assess electron transfer capability.

  • Proteoliposome reconstitution: Incorporation of purified cytochrome b6 into liposomes allows measurement of proton translocation coupled to electron transfer.

  • Blue native PAGE (BN-PAGE): This technique can assess the assembly state of cytochrome b6 into higher-order complexes. Studies have shown that mutations affecting heme binding can be detected through altered migration patterns on BN-PAGE .

What experimental approaches can determine the interaction between recombinant cytochrome b6 and other components of the photosynthetic electron transport chain?

Several sophisticated techniques can characterize interactions between cytochrome b6 and other photosynthetic components:

  • Split-ubiquitin yeast two-hybrid system: This approach has been used successfully to identify protein-protein interactions involving membrane proteins like cytochrome b6. The method involves fusing proteins of interest to complementary fragments of ubiquitin (NubG and Cub domains), with interaction resulting in the activation of reporter genes .

  • Co-immunoprecipitation assays: Using antibodies against cytochrome b6 or its potential interaction partners to isolate protein complexes from solubilized membranes.

  • Surface plasmon resonance (SPR): This technique can measure the binding kinetics between purified cytochrome b6 and other purified components of the electron transport chain.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can identify amino acid residues involved in protein-protein interactions.

  • Fluorescence resonance energy transfer (FRET): This approach can detect proximity between fluorescently labeled proteins in reconstituted systems or in vivo.

Research has shown that cytochrome b6 interacts with both the CCB factors involved in its maturation and with other subunits of the b6f complex. The sequential assembly model suggests that unassembled cytochrome b6, rather than the subunit IV-cytochrome b6 complex, is the substrate for the CCB machinery .

How can recombinant cytochrome b6 be used to study the assembly pathway of the cytochrome b6f complex?

Recombinant cytochrome b6 provides a powerful tool for investigating the complex assembly pathway of the cytochrome b6f complex:

  • Site-directed mutagenesis: By creating specific mutations in the recombinant protein, researchers can identify residues critical for heme binding, protein-protein interactions, and complex assembly. For example, substitution mutants lacking conserved histidines that are axial ligands of bH- or bL-hemes show complete impairment of b6f complex assembly .

  • Reconstitution experiments: Purified recombinant components can be mixed in vitro to study the assembly process and identify assembly intermediates.

  • Pulse-chase experiments: Using inducible expression systems, researchers can follow the time course of protein synthesis, heme incorporation, and complex assembly.

  • Interaction studies with assembly factors: Recombinant cytochrome b6 can be used to identify and characterize interactions with assembly factors like the CCB proteins, which are required for ci-heme binding.

Studies have established a sequential model for cytochrome b6 maturation, with binding of bL-heme, bH-heme, and ci-heme occurring before assembly with other b6f complex components. The biochemical characterization of assembly intermediates has revealed that some forms of the b6f complex can assemble even in the absence of ci-heme binding, though with reduced stability and function .

What methods are most effective for studying heme incorporation into recombinant cytochrome b6?

Heme incorporation into cytochrome b6 is a critical aspect of its maturation and function. Several approaches can be used to study this process:

  • Absorption spectroscopy: Different heme types have characteristic absorption spectra. The b-hemes (bH and bL) show peaks at approximately 560-565 nm in the reduced state, while the ci-heme has distinct spectral properties.

  • Resonance Raman spectroscopy: This technique can provide detailed information about the environment of the heme groups and their coordination state.

  • Heme staining: Peroxidase activity staining after SDS-PAGE can visualize proteins with covalently bound hemes, such as the ci-heme in cytochrome b6.

  • Mass spectrometry: This approach can identify heme-binding peptides and characterize covalent and non-covalent interactions between heme and protein.

  • Genetic manipulation of heme biosynthesis: Using inhibitors like gabaculine or genetic modification of heme biosynthesis pathways can reveal the importance of heme availability for proper cytochrome b6 assembly .

Research has shown that the binding of different hemes to cytochrome b6 follows a sequential order, with bL-heme incorporation being a prerequisite for bH-heme integration. The ci-heme is incorporated last, through a process requiring the CCB factors. This sequential assembly model has been supported by heterologous expression studies of mutant variants of cytochrome b6 in E. coli .

How can researchers use recombinant cytochrome b6 to investigate electron transport mechanisms in photosynthesis?

Recombinant cytochrome b6 provides a valuable tool for investigating electron transport mechanisms:

  • Reconstituted proteoliposome systems: Purified recombinant cytochrome b6, together with other components of the b6f complex, can be incorporated into liposomes to create a simplified system for studying electron transport processes.

  • Electrochemical measurements: Direct electrochemistry of immobilized cytochrome b6 or the reconstituted b6f complex can measure redox potentials and electron transfer rates.

  • Stopped-flow spectroscopy: This technique can measure the kinetics of electron transfer between cytochrome b6 and various electron donors or acceptors.

  • Inhibitor studies: The effects of specific inhibitors like 2,5-dibromo-3-methyl-6-isopropylbenzoquinone on recombinant cytochrome b6 function can provide insights into electron transfer mechanisms .

  • Complementation studies: Introduction of recombinant cytochrome b6 variants into mutant organisms lacking functional cytochrome b6 can assess the in vivo relevance of specific residues or modifications.

Studies on cyanobacterial mutants have shown that even in strains with reduced amounts of cytochrome b6f complex (such as in the petN mutant), some electron transfer activity remains, as indicated by the partial reduction of the plastoquinone pool under normal light conditions .

What are the main challenges in obtaining properly folded and active recombinant cytochrome b6, and how can they be addressed?

Researchers face several challenges when working with recombinant cytochrome b6:

  • Poor expression and inclusion body formation: Membrane proteins like cytochrome b6 often form inclusion bodies when overexpressed. This can be mitigated by:

    • Reducing expression temperature

    • Using weaker promoters or lower inducer concentrations

    • Employing fusion partners that enhance solubility

    • Co-expressing with chaperones

  • Insufficient heme incorporation: To improve heme incorporation:

    • Supplement growth media with heme precursors

    • Co-express heme biosynthesis enzymes

    • Use E. coli strains with enhanced heme synthesis capacity

    • Optimize induction and growth conditions

  • Detergent selection for solubilization: Finding the optimal detergent for solubilization without denaturation requires screening multiple detergents at various concentrations.

  • Aggregation during purification: This can be addressed by:

    • Maintaining detergent above critical micelle concentration throughout purification

    • Including glycerol or other stabilizing agents in buffers

    • Performing chromatography at 4°C

    • Avoiding freeze-thaw cycles (recombinant proteins should be stored at 4°C for up to one week for active use)

  • Lack of functional assays: Developing appropriate functional assays for the recombinant protein, especially when removed from its native context, requires careful consideration of the protein's physiological role.

How can researchers distinguish between native and non-native conformations of recombinant cytochrome b6?

Several analytical approaches can help distinguish between native and non-native conformations:

  • Circular dichroism (CD) spectroscopy: This technique can assess secondary structure content and compare it to predictions or known structures.

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can provide information about tertiary structure and changes in the environment of aromatic residues.

  • Limited proteolysis: Properly folded proteins typically show specific and limited digestion patterns compared to misfolded variants.

  • Thermal stability assays: Differential scanning calorimetry or fluorescence-based thermal shift assays can compare the stability of recombinant proteins to native counterparts.

  • Activity assays: Functional tests, such as peroxidase activity or electron transfer capability, provide the most relevant assessment of native conformation.

  • Spectroscopic analysis of heme incorporation: Properly incorporated hemes show characteristic spectral features that differ from non-specifically bound heme or heme that is not in its native environment.

  • Blue native PAGE: This technique can detect differences in complex formation between native and non-native conformations of the protein .

What approaches can resolve data inconsistencies when comparing results from recombinant versus native cytochrome b6 studies?

When facing inconsistencies between studies using recombinant and native cytochrome b6:

  • Careful comparison of protein constructs: Differences in protein sequence, presence of tags, or truncations may explain functional differences.

  • Assessment of post-translational modifications: Native cytochrome b6 may contain modifications absent in recombinant systems. Mass spectrometry can identify these differences.

  • Evaluation of lipid environment: The lipid composition can significantly affect membrane protein function. Reconstitution of recombinant protein in native-like lipid environments may resolve discrepancies.

  • Analysis of protein-protein interactions: In native systems, cytochrome b6 functions as part of a multi-protein complex. The absence of interaction partners in recombinant systems may explain functional differences.

  • Comparative spectroscopic analysis: Detailed spectroscopic characterization can reveal subtle differences in heme environment or protein conformation.

  • Complementation studies: Introduction of recombinant protein into knockout organisms can test whether it can functionally replace the native protein.

  • Meta-analysis of multiple studies: Systematic review of literature can identify patterns in discrepancies and potential explanations.

Research has shown that assembled forms of the b6f complex in ccb mutants unable to bind ci-heme retain some activity in plastoquinol oxidation, but at levels insufficient for phototrophic growth under standard conditions . Such observations highlight the importance of using multiple approaches to fully characterize protein function.

How can CRISPR-Cas9 genome editing be applied to study cytochrome b6 function in vivo?

CRISPR-Cas9 technology offers powerful approaches for studying cytochrome b6 function:

  • Generation of knockout mutants: Complete deletion of the petB gene to study the consequences of cytochrome b6 absence on photosynthesis and plant growth.

  • Introduction of point mutations: Creating specific mutations in conserved residues to study their role in heme binding, electron transfer, or protein-protein interactions.

  • Tagging endogenous cytochrome b6: Adding fluorescent or affinity tags to the endogenous protein for visualization or purification without overexpression artifacts.

  • Promoter modifications: Altering the native promoter to enable controlled expression for studying cytochrome b6 dosage effects.

  • Humanized experimental systems: Replacing the native petB gene with sequences from different species to study evolutionary conservation and specialization.

  • Conditional knockouts: Creating inducible systems to study the immediate effects of cytochrome b6 loss in established photosynthetic systems.

  • High-throughput mutagenesis: Creating libraries of cytochrome b6 variants for structure-function analysis.

These approaches can be particularly valuable for understanding the role of cytochrome b6 in the context of the complete photosynthetic apparatus, complementing in vitro studies with recombinant proteins.

What are the applications of recombinant cytochrome b6 in synthetic biology and bioenergetics research?

Recombinant cytochrome b6 has several potential applications in synthetic biology:

  • Engineering artificial electron transport chains: Incorporating cytochrome b6 into designed electron transfer systems for bioenergy applications.

  • Developing biosensors: Using the redox-sensitive properties of cytochrome b6 to create sensors for electron transfer efficiency or inhibitors.

  • Improving photosynthetic efficiency: Engineering optimized variants of cytochrome b6 with enhanced electron transfer rates or stability.

  • Creating minimal photosynthetic systems: Building simplified systems containing only essential components for fundamental research and application.

  • Biohybrid devices: Combining recombinant cytochrome b6 with inorganic materials for light-harvesting and energy conversion technologies.

  • Metabolic engineering: Modifying electron transport components to redirect electron flow for the production of high-value compounds or biofuels.

  • Studying evolutionary adaptations: Comparing cytochrome b6 variants from different photosynthetic organisms to understand evolutionary adaptations to different light environments.

The understanding gained from basic research on cytochrome b6 structure and function can inform these applications, particularly regarding the critical role of proper heme incorporation for electron transfer function.

How can structural biology techniques be combined with functional studies to advance our understanding of cytochrome b6 dynamics?

Integrating structural and functional approaches provides deeper insights into cytochrome b6:

  • Time-resolved X-ray crystallography: This technique can capture intermediate states during electron transfer, providing insights into conformational changes associated with function.

  • Cryo-electron microscopy (cryo-EM): High-resolution cryo-EM structures of the b6f complex in different states can reveal dynamic aspects not captured in static crystal structures.

  • Molecular dynamics simulations: Computational approaches can model the dynamics of cytochrome b6 within the membrane environment and predict how mutations might affect function.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of cytochrome b6 that undergo conformational changes during function or interaction with other proteins.

  • Single-molecule FRET: By labeling specific sites on cytochrome b6, researchers can monitor conformational changes in real-time at the single-molecule level.

  • Pulsed electron paramagnetic resonance (EPR): This approach can measure distances between paramagnetic centers (such as hemes) and track changes during electron transfer.

  • Neutron scattering: This technique can provide information about hydrogen positions and water networks that may be critical for proton-coupled electron transfer.

These integrated approaches can help resolve questions about how electron transfer through cytochrome b6 is coupled to proton translocation, and how the protein's dynamics contribute to its function in both linear and cyclic electron transport pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.