Recombinant Nymphaea alba Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Genomic Context in Nymphaea alba

Though not directly linked to ccsA, Nymphaea alba's chloroplast genome exhibits features relevant to cytochrome c biogenesis:

FeatureDescriptionSource
Chloroplast GenomeQuadripartite structure with ~130 genes
SSRs227–229 microsatellites, predominantly A/T-rich mononucleotide repeats
Intron-Containing Genes12 genes, including ndhA (longest intron: 1,084–1,089 bp)

These genomic traits suggest a conserved framework for heme-related processes, though specific ccsA studies in Nymphaea alba are absent .

Cytochrome c Biogenesis in Plants

In angiosperms, cytochrome c biogenesis involves mitochondrial and chloroplast pathways. While bacterial systems rely on ccsA/B, plants may utilize alternative enzymes (e.g., mitochondrial import machinery). For example:

  • Chloroplast Genomes: Nymphaea alba’s chloroplast genome encodes 85 protein-coding genes, including those for photosynthesis and electron transport chains .

  • Hybridization Studies: Molecular cloning of Nymphaea alba var. rubra revealed genetic recombination in ITS regions, highlighting genomic plasticity .

Comparative Genomics

Comparative analyses of basal angiosperms (e.g., Nymphaea, Amborella) show IR boundary contractions and SSR distributions, which may influence gene expression and heme-related pathways .

Table 1: SSR Distribution in Nymphaea alba Chloroplast Genome

SSR TypeCountMotif Composition
Mononucleotide65–78Primarily A/T
Dinucleotide70–83A/T-dominated
Trinucleotide57–64Mixed A/T/G/C
Total SSRs227–229~69% in non-coding regions

Data adapted from chloroplast genome studies .

Table 2: Recombinant ccsA Production Parameters

ParameterTrachelium caeruleum ccsAHypothetical Nymphaea alba ccsA
HostE. coliE. coli or plant systems
TagHis-tagHis-tag or other tags
PurificationAffinity chromatographySimilar methods
ApplicationsStructural studies, heme attachment assaysTheoretical: cytochrome c biogenesis research

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please communicate your preference, and we will prioritize developing the specified tag.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Nymphaea alba (White water-lily) (Castalia alba)
Target Names
ccsA
Target Protein Sequence
MIFATLEHILTHISFSIISIVIPTHLMTLVYEIVGLCDSSEKGMITTFFCITGLLVTRWI YSGHVPLSDLYESLMFLSWSFSLIHIVPYFRNYKNFFSKITAPSAILTQGFATSGLLTKM HQSAILVPALQSRWLMMHVSMMLLSYAALLCGSLLSITLLVITFRRKIDIFGKTNHLLIS SFSFDETQYVNFSFRNYHRYQLTQRLDYWSYRVIGLGFTLLTIGILSGAVWANEAWGSYW NWDPKETWAFITWTVFAIYLHTRTNKSLQGANSAIVASMGFLIIWICYFGVNLLGRGLHS YGSFTLNI
Uniprot No.

Target Background

Function
Essential during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the stage of heme attachment.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Nymphaea alba ccsA and what is its role in cytochrome c biogenesis?

Nymphaea alba cytochrome c biogenesis protein ccsA is a membrane-bound component of the cytochrome c biogenesis System II, which is responsible for the post-translational maturation of c-type cytochromes. This system is found in β-, δ- and ε-proteobacteria, Gram-positive bacteria, cyanobacteria, as well as in algal and plant chloroplasts, including aquatic plants like Nymphaea alba (European white water lily) .

The ccsA protein functions specifically as part of the cytochrome c synthase complex, working in conjunction with CcsB to facilitate the stereospecific covalent attachment of heme to apocytochrome c. This occurs via thioether bonds formed between the vinyl groups of heme b and reduced cysteine residues in the apocytochrome's heme c attachment motif . In Nymphaea alba, this protein is crucial for proper electron transport chain function within chloroplasts, supporting both photosynthesis and various metabolic processes that contribute to the plant's documented biological activities, including antioxidant, antifungal, and antitumoral properties .

The protein contains transmembrane domains and is typically located in the thylakoid membrane of chloroplasts, where it participates in the complex process of cytochrome maturation that involves heme handling, apocytochrome reduction, and the final stereospecific heme attachment reaction.

How are recombinant forms of Nymphaea alba ccsA typically expressed and purified?

Recombinant Nymphaea alba ccsA is typically expressed using heterologous expression systems optimized for membrane proteins. The methodology involves several critical steps:

  • Gene Cloning and Vector Construction: The ccsA gene is isolated from Nymphaea alba using PCR with specific primers designed based on conserved regions of known ccsA sequences. The amplified gene is then cloned into an expression vector containing appropriate promoters and tags for detection and purification .

  • Expression Systems: Due to the membrane-bound nature of ccsA, specialized expression systems are required:

    • E. coli-based systems with modified strains (C41, C43) engineered for membrane protein expression

    • Yeast systems (Pichia pastoris, Saccharomyces cerevisiae) for eukaryotic processing

    • Insect cell/baculovirus systems for more complex eukaryotic post-translational modifications

  • Extraction and Purification: These typically involve:

    • Membrane fraction isolation via differential centrifugation

    • Solubilization using mild detergents (DDM, LMNG, or digitonin)

    • Affinity chromatography utilizing histidine or other fusion tags

    • Size exclusion chromatography for final purification and detergent exchange

  • Verification: Confirmation of correct protein expression through:

    • SDS-PAGE analysis

    • Western blotting with anti-His or specific anti-ccsA antibodies

    • Mass spectrometry for protein identification

The choice of expression system significantly impacts yield and functionality, with E. coli systems providing higher yields but potential folding issues, while eukaryotic systems may provide better folding but lower yields.

What experimental techniques are most effective for characterizing Nymphaea alba ccsA function?

Multiple complementary techniques are employed to comprehensively characterize Nymphaea alba ccsA function:

  • In vitro Reconstitution Assays: Reconstituted systems containing purified recombinant Nymphaea alba ccsA, CcsB, and additional components necessary for cytochrome c maturation are used to assess heme attachment activity. The formation of mature cytochrome c can be monitored spectrophotometrically by measuring the characteristic absorption spectrum of covalently bound heme c.

  • Site-Directed Mutagenesis: Strategic mutations of conserved residues help identify amino acids essential for heme binding, interaction with partner proteins, or catalytic activity. System II cytochrome c synthase contains conserved histidine residues that are thought to coordinate heme during the attachment process .

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify interactions with CcsB and other components

    • Yeast two-hybrid or split-GFP assays for in vivo interaction mapping

    • Crosslinking studies to capture transient interactions during the cytochrome maturation process

  • Structural Analysis:

    • Circular dichroism spectroscopy for secondary structure assessment

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Cryo-electron microscopy for structural determination of the membrane protein complex

  • Functional Complementation: Expression of Nymphaea alba ccsA in ccsA-deficient bacterial or plant systems to assess functional restoration of cytochrome c maturation.

These methods collectively provide insights into both structural features and mechanistic aspects of ccsA function in the context of the complete System II machinery.

What are the molecular mechanisms of heme handling and transfer by Nymphaea alba ccsA?

The molecular mechanisms of heme handling and transfer by Nymphaea alba ccsA involve sophisticated coordination between multiple domains and cofactors:

  • Transmembrane Heme Channel: Based on studies of System II components, Nymphaea alba ccsA likely contains a transmembrane channel formed by its TM domains that facilitates heme transport across the membrane. This channel is thought to be lined with conserved histidine residues that coordinate the heme iron during transport .

  • WWD Domain Function: The conserved tryptophan-rich WWD domain (containing the signature Trp-Trp-Asp motif) is critical for heme binding and handling. This domain likely functions to:

    • Recognize and bind heme b via π-stacking interactions between the porphyrin ring and aromatic residues

    • Position heme correctly for the subsequent stereospecific attachment reaction

    • Potentially participate in redox reactions to maintain heme in the correct oxidation state

  • Proposed Reaction Mechanism: The current model suggests a step-wise process:

    • Heme b binding to ccsA in the transmembrane domain

    • Conformational change to expose heme for interaction with the apocytochrome

    • Coordination with CcsB to bring the reduced thiols of the CXXCH motif in proximity to the heme vinyl groups

    • Catalysis of thioether bond formation, potentially through a nucleophilic addition mechanism

  • Coordination with Redox Partners: Nymphaea alba ccsA likely works in concert with CcdA and CcsX (ResA) homologs that maintain the reducing environment necessary for keeping the cysteine residues of the apocytochrome in the reduced state required for thioether bond formation .

Understanding these mechanisms has been challenging due to the membrane-bound nature of the protein and the complexity of reconstituting the complete system in vitro.

How does Nymphaea alba ccsA differ structurally and functionally from bacterial homologs?

Significant structural and functional differences exist between Nymphaea alba ccsA and its bacterial counterparts:

  • Domain Organization:

    • Nymphaea alba ccsA contains chloroplast-specific N-terminal transit peptides for proper organellar targeting

    • Plant ccsA proteins typically have additional transmembrane segments compared to some bacterial homologs

    • The positioning and number of conserved histidine residues in the transmembrane domains show plant-specific patterns

  • Interaction Partners:

    • Unlike some bacterial systems where CcsA and CcsB are fused (as in some ε-proteobacteria with CcsBA fusion proteins) , Nymphaea alba maintains these as separate proteins

    • The plant system likely has evolved specific interaction surfaces that facilitate binding to plant-specific CcsB proteins

  • Substrate Specificity:

    • Nymphaea alba ccsA has evolved to recognize plant-specific c-type cytochromes, particularly plastid cytochromes like cytochrome f and cytochrome c6

    • The binding pocket for the CXXCH motif has likely adapted to accommodate plant-specific sequence variations

  • Evolutionary Adaptations:

    • Aquatic environment adaptations may influence protein stability and function

    • As an aquatic flowering plant, Nymphaea alba may have evolved specific features in ccsA to function optimally under fluctuating oxygen levels typical in aquatic environments

  • Regulatory Mechanisms:

    • Plant systems likely have evolved light-dependent or developmental regulation mechanisms absent in bacterial systems

    • Stress response elements may be integrated into the plant System II that are not present in bacterial homologs

These differences reflect the evolutionary adaptation of the cytochrome c biogenesis system to the specific requirements of plant chloroplasts, which differ substantially from the bacterial periplasmic environment.

What are the current challenges in expressing functional recombinant Nymphaea alba ccsA?

Researchers face numerous challenges when attempting to express functional recombinant Nymphaea alba ccsA:

  • Membrane Protein Expression Barriers:

    • Toxicity to host cells during overexpression

    • Misfolding and aggregation in heterologous systems

    • Inefficient insertion into host membranes

    • Challenges in maintaining the native conformation during solubilization

  • Functional Assessment Complexities:

    • Requirement for partner proteins (CcsB) for complete functional analysis

    • Need for specialized assays to detect heme attachment activity

    • Difficulty in distinguishing between structural defects and functional deficiencies

  • System-Specific Technical Challenges:

Expression SystemAdvantagesChallengesPotential Solutions
E. coliHigh yield, rapid growthLack of eukaryotic PTMs, inclusion body formationUse C41/C43 strains, lower induction temperature (16-20°C), fusion with solubility tags
Yeast systemsEukaryotic processing, better foldingLower yields, glycosylation differencesCodon optimization, inducible promoters, optimized growth media
Insect cell/baculovirusSuperior for complex eukaryotic proteinsTime-consuming, expensive, specialized equipment neededBacmid optimization, cell line selection, infection ratio optimization
Cell-free systemsAvoids toxicity issues, rapidLimited scalability, expensiveSupplementation with chaperones, membrane mimetics
  • Reconstitution Challenges:

    • Finding suitable membrane mimetics (nanodiscs, liposomes) that maintain protein function

    • Achieving correct orientation in artificial membranes

    • Co-reconstitution with partner proteins in correct stoichiometry

  • Stability Issues:

    • Limited stability after purification

    • Sensitivity to detergent choice and concentration

    • Loss of essential cofactors during purification

These challenges necessitate a comprehensive approach combining protein engineering, optimized expression conditions, and specialized characterization techniques to obtain functional recombinant protein.

How can site-directed mutagenesis of Nymphaea alba ccsA inform structure-function relationships?

Site-directed mutagenesis represents a powerful approach to elucidate structure-function relationships in Nymphaea alba ccsA by allowing targeted modification of specific amino acids. Key applications include:

  • Identification of Essential Residues: Systematic mutation of conserved amino acids can reveal those critical for:

    • Heme binding (conserved histidines in transmembrane regions)

    • Interaction with CcsB (interface residues)

    • Catalytic activity (residues involved in facilitating thioether bond formation)

    • Substrate recognition (residues that interact with the CXXCH motif)

  • Domain Function Mapping: Creating chimeric proteins by swapping domains between Nymphaea alba ccsA and homologs from other species can identify domains responsible for substrate specificity and functional differences.

  • Transmembrane Topology Validation: Introduction of reporter tags or glycosylation sites at strategic positions can confirm the predicted membrane topology of the protein.

  • Mechanism Elucidation: Strategic mutations can test hypotheses about the reaction mechanism:

    • Mutation of proposed heme-coordinating histidines should abolish activity

    • Alteration of residues in the WWD domain should affect heme binding but not necessarily protein structure

    • Modification of proposed substrate-binding residues may alter substrate specificity

  • Engineering Enhanced Variants: Rational design based on structural insights can potentially:

    • Improve expression and stability in recombinant systems

    • Enhance activity under specific experimental conditions

    • Create variants with altered substrate specificity

Previous studies on bacterial cytochrome c biogenesis systems have demonstrated that highly conserved histidine residues in CcsA are essential for function, and similar approaches applied to Nymphaea alba ccsA would likely yield valuable insights into the plant-specific aspects of the system .

What research applications exist for recombinant Nymphaea alba ccsA beyond basic characterization?

Recombinant Nymphaea alba ccsA offers diverse research applications beyond basic characterization:

  • Synthetic Biology Applications:

    • Development of engineered cytochrome c maturation systems with enhanced efficiency

    • Creation of minimal synthetic systems for cytochrome c production in non-native hosts

    • Design of hybrid biogenesis systems combining elements from different organisms

  • Biotechnological Applications:

    • Production of modified c-type cytochromes with novel properties

    • Development of biosensors utilizing the specific heme-binding properties

    • Potential applications in bioremediation systems leveraging electron transport capabilities

  • Structural Biology Platform:

    • Model system for studying membrane protein complexes

    • Template for understanding other plant membrane transporters

    • Platform for developing membrane protein crystallization methods

  • Evolutionary Studies:

    • Investigation of the evolution of System II cytochrome c biogenesis in aquatic plants

    • Comparative analysis with homologs from other Nymphaeaceae family members

    • Study of adaptation of cytochrome maturation systems to aquatic environments

  • Plant Adaptation Research:

    • Understanding how Nymphaea alba's electron transport systems contribute to its adaptation to aquatic environments

    • Investigation of the role of efficient cytochrome c biogenesis in the plant's documented antioxidant properties

    • Exploration of connections between cytochrome c maturation and stress responses in aquatic plants

  • Potential Therapeutic Relevance:

    • Exploration of connections to the plant's documented antifungal activity, particularly against Candida species

    • Investigation of how efficient electron transport systems may contribute to the production of bioactive compounds with antitumoral properties

These applications highlight the broad relevance of Nymphaea alba ccsA research beyond its immediate role in cytochrome c biogenesis.

What are the optimal conditions for functional assays of recombinant Nymphaea alba ccsA?

The successful functional assessment of recombinant Nymphaea alba ccsA requires carefully optimized conditions:

  • Reconstitution Parameters:

    • Membrane mimetic selection: Nanodiscs with plant lipid compositions (particularly containing MGDG and DGDG) often outperform standard detergent micelles

    • Protein:lipid ratios: Typically 1:100-1:200 (w/w) for optimal activity

    • Buffer composition: 50 mM Tris-HCl or HEPES buffer (pH 7.2-7.5) supplemented with 100-150 mM NaCl and 5-10% glycerol

  • Partner Protein Requirements:

    • Co-expression or co-reconstitution with CcsB is essential for complete activity

    • Addition of thioredoxin-like proteins (CcsX homologs) enhances activity by maintaining reduced thiols

    • Stoichiometric ratio of CcsA:CcsB of 1:1 typically yields optimal activity

  • Substrate Considerations:

    • Apocytochrome substrate selection: Both native plant apocytochromes and synthetic peptides containing the CXXCH motif can be used

    • Heme source: Fresh preparation of hemin dissolved in DMSO at 10 mM, with final assay concentrations of 5-20 μM

    • Reducing agents: Addition of 1-5 mM DTT or TCEP to maintain reduced thiols

  • Assay Conditions:

ParameterOptimal RangeNotes
Temperature25-30°CHigher temperatures may destabilize the complex
pH7.2-7.5Activity decreases significantly below pH 7.0
Ionic strength100-150 mM NaClHigher salt concentrations may disrupt protein-protein interactions
Time course15-60 minutesLonger incubations rarely increase yield
Detection methodAbsorbance at 550-552 nmAfter reduction with sodium dithionite
  • Controls and Validations:

    • Negative controls: Heat-inactivated enzyme, omission of key components

    • Positive controls: Bacterial CcsA/CcsB with known activity

    • Validation: HPLC analysis of formed heme c products, mass spectrometry verification

These optimized conditions accommodate the specific requirements of plant chloroplast proteins while maximizing the functional output of the reconstituted system.

How can researchers troubleshoot expression and purification issues with Nymphaea alba ccsA?

Troubleshooting expression and purification of Nymphaea alba ccsA requires systematic investigation of potential issues:

  • Low Expression Yields:

    • Problem: Toxicity to host cells

    • Solution: Use tightly regulated inducible promoters, lower induction temperatures (16-20°C), reduced inducer concentrations

    • Problem: Codon bias issues

    • Solution: Codon optimization for expression host, use of Rosetta or similar strains for E. coli expression

    • Problem: mRNA stability or secondary structure issues

    • Solution: Optimize 5' UTR, remove rare codons or repetitive sequences

  • Protein Aggregation/Inclusion Bodies:

    • Problem: Improper membrane insertion

    • Solution: Co-expression with chaperones (GroEL/ES, DnaK/J), fusion with solubility-enhancing tags (MBP, SUMO)

    • Problem: Toxicity leading to sequestration

    • Solution: Lower expression rate, use specialized strains (C41/C43 for E. coli)

    • Problem: Improper disulfide formation

    • Solution: Expression in strains with oxidizing cytoplasm or with disulfide isomerases

  • Purification Challenges:

ChallengeSymptomsSolution Strategies
Poor solubilizationLow yield after membrane extractionScreen detergent panel (DDM, LMNG, digitonin); optimize detergent:protein ratio; test solubilization time and temperature
Aggregation during purificationElution in void volume during SECAdd glycerol (5-10%); maintain CMC of detergent; consider lipid supplementation
Poor binding to affinity resinLow yield from affinity stepOptimize tag position (N vs C-terminal); use longer linkers; try alternative tags
ProteolysisMultiple bands on SDS-PAGEAdd protease inhibitors; optimize purification speed; reduce purification temperature
Loss of activityPurified protein lacks functionOptimize detergent exchange; reconstitute into nanodiscs or liposomes; add stabilizing agents
  • Verification Techniques:

    • Western blotting with antibodies against the tag or protein

    • Mass spectrometry to confirm protein identity

    • Circular dichroism to assess secondary structure integrity

    • Fluorescence-based thermal shift assays to optimize buffer conditions

  • Expression System Selection:

    • If E. coli fails, consider Pichia pastoris for improved folding

    • For complex functional studies, insect cell expression often provides superior results

    • Cell-free systems allow rapid screening of conditions without cellular toxicity concerns

Systematic application of these troubleshooting approaches, ideally testing multiple variables simultaneously through factorial experimental design, can significantly improve success rates for this challenging membrane protein.

What bioinformatic approaches can predict functional motifs in Nymphaea alba ccsA?

Advanced bioinformatic approaches provide valuable insights into functional elements of Nymphaea alba ccsA:

  • Sequence Conservation Analysis:

    • Multiple sequence alignment (MSA) of ccsA homologs across species using MUSCLE or MAFFT

    • Conservation scoring using ConSurf or Rate4Site to identify functionally important residues

    • Identification of plant-specific conserved motifs through comparison with bacterial homologs

  • Structure Prediction and Analysis:

    • Transmembrane topology prediction using TMHMM, TOPCONS, or Phobius

    • Ab initio structure prediction using AlphaFold2 or RoseTTAFold

    • Homology modeling based on available structures of bacterial homologs

    • Molecular dynamics simulations to identify flexible regions and stable structural elements

  • Functional Motif Prediction:

    • Identification of heme-binding motifs through pattern matching (WWD domain, histidine-rich regions)

    • Prediction of protein-protein interaction sites using PIPE or SPRINT

    • Identification of potential substrate binding pockets using CASTp or POCASA

  • Evolutionary Analysis:

    • Phylogenetic analysis to trace the evolutionary history of ccsA in aquatic plants

    • Detection of positively selected sites using PAML or HyPhy

    • Coevolutionary analysis to identify residues that have coevolved with interaction partners

  • Machine Learning Approaches:

    • Deep learning methods to predict protein function from sequence

    • Feature extraction from multiple sequence alignments

    • Prediction of post-translational modifications or regulatory sites

The integration of these computational approaches provides a comprehensive framework for generating testable hypotheses about Nymphaea alba ccsA function, guiding experimental design, and interpreting experimental results in the context of evolutionary conservation.

How does Nymphaea alba ccsA research contribute to understanding plant adaptation to aquatic environments?

Research on Nymphaea alba ccsA provides significant insights into plant adaptation to aquatic environments:

  • Electron Transport Adaptations:

    • Efficient cytochrome c maturation is crucial for optimal electron transport chain function in fluctuating oxygen conditions typical of aquatic environments

    • Nymphaea alba's adaptation to aquatic life may be reflected in specialized features of its cytochrome c biogenesis system that optimize function under hypoxic conditions

    • The ccsA protein may contribute to the plant's ability to maintain redox balance during environmental stress

  • Metabolic Support for Bioactive Compound Production:

    • Efficient electron transport supported by optimized cytochrome c biogenesis potentially underpins the plant's ability to produce diverse bioactive compounds

    • The documented antioxidant properties of Nymphaea alba extracts may be partially dependent on effective cytochrome systems that minimize reactive oxygen species generation

    • Metabolic pathways leading to the production of medicinal compounds (polyphenols, flavonoids) identified in Nymphaea alba may be supported by efficient cytochrome c function

  • Evolutionary Perspectives:

    • Comparative analysis of ccsA across aquatic and terrestrial plants can reveal adaptive signatures

    • Nymphaea alba represents an important evolutionary position as an early-diverging angiosperm with both primitive and derived features

    • Understanding specialized features of cytochrome biogenesis in this species provides insights into the evolution of photosynthetic adaptations to aquatic life

  • Stress Response Mechanisms:

    • Cytochrome c biogenesis may play a role in adaptation to the specific stresses of aquatic environments (varying light penetration, temperature fluctuations, periodic hypoxia)

    • Research on ccsA contributes to understanding how electron transport chain components are regulated during environmental stress

    • Potential specialized features may exist to protect cytochrome maturation during environmental transitions

This research connects molecular-level protein function to broader ecological adaptations, providing insights into how biochemical systems evolve to support plant life in challenging aquatic habitats.

What are promising future research directions for Nymphaea alba ccsA studies?

Several promising research directions could advance our understanding of Nymphaea alba ccsA:

  • Structural Biology Frontiers:

    • Determination of high-resolution structure using cryo-electron microscopy in complex with CcsB

    • Dynamic structural studies using hydrogen-deuterium exchange mass spectrometry to identify conformational changes during the catalytic cycle

    • Time-resolved studies to capture intermediate states during heme attachment

  • Systems Biology Integration:

    • Transcriptomic analysis to understand regulatory networks controlling ccsA expression during development and stress

    • Metabolomic studies to connect cytochrome c biogenesis efficiency with production of bioactive compounds

    • Proteomic analysis of interaction networks surrounding the cytochrome c biogenesis system

  • Synthetic Biology Applications:

    • Engineering optimized cytochrome c biogenesis systems for heterologous expression

    • Development of biosensors based on ccsA heme-binding properties

    • Creation of minimal synthetic systems for studying cytochrome c maturation

  • Comparative Evolutionary Studies:

    • Detailed analysis across the Nymphaeaceae family to understand species-specific adaptations

    • Broader comparisons between aquatic and terrestrial plants to identify aquatic adaptation signatures

    • Investigation of how cytochrome c biogenesis systems have adapted to various ecological niches

  • Therapeutic Potential Exploration:

    • Investigation of connections between efficient cytochrome c biogenesis and production of bioactive compounds

    • Exploration of how electron transport efficiency contributes to the plant's documented medicinal properties

    • Potential applications in developing new antimicrobial or antitumoral compounds based on understanding of Nymphaea alba metabolism

These research directions collectively would advance both fundamental understanding of this important protein system and potential applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.