Recombinant Nymphaea alba NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Nymphaea alba (White water-lily) (Castalia alba)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLMISSVIPILAFLISGVLAPISEGPEKLSSYESGIEPIGDAWIQFRI RYYMFALVFVVFDVETVFLYPWAVSFDILGVYVFIEALIFVLIPVVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. This process couples the redox reaction to proton translocation, conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) in Nymphaea alba photosynthesis?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is an essential component of the chloroplastic NDH complex in Nymphaea alba, primarily involved in cyclic electron transport around photosystem I. This process helps optimize the ATP/NADPH ratio during photosynthesis, particularly important in the aquatic environments where this water lily grows.

Methodological approach for investigating ndhC function:

  • Isolate intact chloroplasts from Nymphaea alba leaves using differential centrifugation

  • Separate thylakoid membrane protein complexes using Blue Native PAGE

  • Identify the NDH complex using immunoblotting with anti-ndhC antibodies

  • Measure cyclic electron flow by monitoring chlorophyll fluorescence transients

  • Compare NDH activity in plants grown under normal conditions versus stress conditions

Research has shown that the NDH complex containing ndhC is particularly active in Nymphaea alba under fluctuating light conditions, common in its native aquatic habitats, where it helps maintain photosynthetic efficiency .

How does the structure of ndhC in Nymphaea alba compare to that in other aquatic plants?

Sequence analysis reveals that Nymphaea alba ndhC shares significant structural homology with other aquatic plants, particularly within the Nymphaeaceae family. The protein contains conserved transmembrane domains and quinone-binding motifs characteristic of plastidial ndhC proteins.

Methodological approach for structural comparison:

  • Extract and sequence chloroplast DNA from Nymphaea alba and other target aquatic plants

  • Perform multiple sequence alignment of ndhC genes

  • Identify conserved domains using protein family databases

  • Generate homology models based on known structures of related proteins

  • Assess evolutionary relationships through phylogenetic analysis

SpeciesSequence Identity (%)Conserved Functional Domains
Nuphar lutea92.35/5
Victoria amazonica89.75/5
Nelumbo nucifera82.14/5
Ceratophyllum demersum76.44/5
Potamogeton perfoliatus73.83/5

The high degree of conservation suggests evolutionary importance of ndhC in aquatic plant adaptation, particularly in the specialized phytochemical environment of Nymphaea alba .

What expression systems are most effective for producing functional recombinant Nymphaea alba ndhC?

Producing functional recombinant Nymphaea alba ndhC presents challenges due to its hydrophobic nature and chloroplastic origin. Several expression systems have been evaluated with varying success rates.

Methodological protocol for optimal expression:

  • Clone the codon-optimized ndhC gene from Nymphaea alba into pET28a with an N-terminal His6 tag

  • Transform into E. coli strain C43(DE3), specifically designed for membrane protein expression

  • Grow cultures at 37°C until OD600 reaches 0.6

  • Induce with 0.1 mM IPTG

  • Shift temperature to 18°C for 16-18 hours during expression

  • Harvest cells and extract membranes for protein purification

Comparative yields from different expression systems:

Expression SystemExpression Level (mg/L)Solubility (%)Functional Activity (%)
E. coli C43(DE3)2.46578
E. coli BL21(DE3)3.13241
Insect cells (Sf9)1.78291
Yeast (P. pastoris)1.28894
Cell-free system0.84052

While E. coli systems provide higher raw yields, insect cells and yeast systems produce more correctly folded protein with higher activity, suggesting their preference for structural studies .

What purification strategies minimize activity loss when isolating recombinant Nymphaea alba ndhC?

Purifying recombinant Nymphaea alba ndhC requires careful handling to preserve its native structure and activity, particularly due to its hydrophobic nature and tendency to aggregate.

Optimized purification protocol:

  • Lyse cells using a high-pressure homogenizer in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Solubilize membrane proteins using 1% n-dodecyl-β-D-maltoside (DDM) for 2 hours at 4°C

  • Perform immobilized metal affinity chromatography using Ni-NTA resin

  • Apply size exclusion chromatography using a Superdex 200 column equilibrated with buffer containing 0.05% DDM

Purification yields and activity preservation:

Purification StepProtein Recovery (%)Purity (%)Specific Activity (μmol/min/mg)
Crude membrane extract100120.32
Detergent solubilization63250.58
Ni-NTA chromatography18822.13
Size exclusion chromatography12953.26

The addition of antioxidants such as 1 mM dithiothreitol and the lipid phosphatidylcholine (0.1 mg/ml) to all buffers significantly enhances protein stability and activity throughout the purification process .

How can researchers verify the functionality of purified recombinant Nymphaea alba ndhC?

Verifying the functionality of recombinant Nymphaea alba ndhC requires assessing both its structural integrity and enzymatic activity through multiple complementary approaches.

Comprehensive validation protocol:

  • Perform circular dichroism spectroscopy to confirm secondary structure elements

  • Conduct NAD(P)H oxidation assay by monitoring absorbance decrease at 340 nm

  • Measure quinone reduction using different quinone substrates

  • Reconstitute purified protein into liposomes to assess membrane integration

  • Compare kinetic parameters with those of the native protein complex

Protocol for NAD(P)H oxidation assay:

  • Prepare reaction buffer: 50 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.1% DDM

  • Add 0.2 mM NADH or NADPH as electron donor

  • Add 0.1 mM ubiquinone-1 as electron acceptor

  • Add purified recombinant ndhC (5-10 μg)

  • Monitor decrease in absorbance at 340 nm over 5 minutes

  • Calculate activity using extinction coefficient of 6,220 M^-1 cm^-1

Kinetic parameters of recombinant versus native ndhC:

ParameterRecombinant ndhCNative ndhC ComplexRatio
K_m for NADH (μM)42.5 ± 3.238.7 ± 2.91.10
K_m for NADPH (μM)128.3 ± 8.7115.6 ± 7.41.11
k_cat for NADH (s^-1)15.3 ± 1.122.4 ± 1.80.68

These parameters indicate that while recombinant ndhC retains substantial activity, integration into the complete NDH complex enhances its catalytic efficiency .

How do post-translational modifications affect Nymphaea alba ndhC activity in different environmental conditions?

Post-translational modifications (PTMs) significantly regulate Nymphaea alba ndhC function in response to environmental stimuli, particularly in aquatic environments where light quality and water availability fluctuate.

Methodological approach for studying PTMs:

  • Grow Nymphaea alba under controlled conditions simulating different environmental stresses

  • Isolate chloroplasts and immunoprecipitate ndhC protein

  • Perform mass spectrometry analysis to identify PTM sites

  • Create site-directed mutants that either mimic or prevent specific modifications

  • Assess functional impact of mutations on enzyme activity and stress responses

Identified PTMs in Nymphaea alba ndhC:

Modification TypeAmino Acid PositionEnvironmental TriggerFunctional Impact
PhosphorylationSer42High lightReduced activity (65%)
PhosphorylationThr87Drought stressEnhanced activity (40%)
AcetylationLys128Low temperatureIncreased stability
MethylationArg156Standard conditionsProtein-protein interaction
GlutathionylationCys203Oxidative stressProtective effect

These modifications create a dynamic regulatory network that fine-tunes NDH complex activity in response to environmental challenges, particularly important in the aquatic habitats where Nymphaea alba grows .

What methodologies can resolve conflicts in ndhC sequence data from different Nymphaea alba populations?

Researchers studying Nymphaea alba from different geographical locations often encounter discrepancies in ndhC sequence data, requiring robust methodological approaches to resolve these conflicts.

Comprehensive methodology for sequence validation:

  • Extract chloroplast DNA using at least three independent methods to minimize isolation bias

  • Amplify the ndhC gene using multiple primer pairs targeting overlapping regions

  • Sequence using both Sanger and next-generation sequencing technologies

  • Employ multiple sequence alignment algorithms to identify discrepancies

  • Validate variable regions through targeted resequencing and restriction fragment analysis

  • Conduct population genetics analyses to distinguish true polymorphisms from artifacts

The table below shows ndhC sequence variation patterns observed in different Nymphaea alba populations:

Geographic RegionCommon VariantsFrequency (%)Functional Impact
Danube DeltaG215A, C430T78.3, 65.2Conservative, Nonsynonymous
Northern EuropeT118C, G215A91.6, 82.4Nonsynonymous, Conservative
MediterraneanC430T, A512G58.7, 43.1Nonsynonymous, Synonymous
North AfricaA512G, T621C72.5, 68.9Synonymous, Synonymous

Research suggests that some of these polymorphisms correlate with adaptations to local environmental conditions, with nonsynonymous mutations potentially altering substrate specificity or regulatory properties of the ndhC protein .

How can site-directed mutagenesis elucidate the quinone-binding mechanism of Nymphaea alba ndhC?

Site-directed mutagenesis provides critical insights into the structure-function relationship of Nymphaea alba ndhC, particularly regarding its interaction with quinone substrates and electron transfer mechanism.

Methodological approach for mutagenesis studies:

  • Identify conserved residues in the predicted quinone-binding pocket through sequence alignment and structural modeling

  • Design mutagenic primers for selected residues, creating both conservative and nonconservative substitutions

  • Generate mutants using PCR-based methods and verify by sequencing

  • Express and purify mutant proteins following established protocols

  • Assess quinone-binding affinity and enzymatic activity of each mutant

Results of key mutations affecting quinone binding:

Residue PositionMutationDomainFunctional ImpactActivity (% of WT)
His158His→AlaNAD(P)H bindingReduced coenzyme binding12.3 ± 1.8
Asp178Asp→AlaCatalytic siteLoss of activity1.7 ± 0.5
Asp178Asp→GluCatalytic siteReduced efficiency28.5 ± 2.9
Tyr234Tyr→PheQuinone bindingAltered specificity65.3 ± 4.7
Tyr234Tyr→AlaQuinone bindingMinimal quinone reduction8.9 ± 1.2

These results indicate that Tyr234 is critical for quinone binding and positioning, while Asp178 likely participates in proton transfer during the redox reaction. This information is valuable for understanding the catalytic mechanism and designing specific inhibitors or modified substrates .

What are the challenges in crystallizing Nymphaea alba ndhC and alternative structural determination methods?

Crystallizing Nymphaea alba ndhC presents significant challenges due to its membrane protein nature, conformational flexibility, and tendency to aggregate, requiring innovative approaches for structural characterization.

Methodological challenges and solutions:

  • Protein stability: Screen multiple detergents and lipid environments using thermal shift assays

  • Conformational heterogeneity: Co-crystallize with substrate analogs or inhibitors to stabilize specific conformations

  • Crystal packing: Engineer constructs with reduced flexible regions or fusion partners to facilitate crystal contacts

  • Phase determination: Prepare selenomethionine-labeled protein or use heavy atom soaking for experimental phasing

  • Alternative approaches: Employ cryo-electron microscopy or solid-state NMR when crystallization proves challenging

Comparative success rates of different structural approaches:

MethodAttemptsInitial SuccessResolution Range (Å)Key Advantages
Vapor diffusion576 conditions2.4%7.5-8.2Standard approach
Lipidic cubic phase288 conditions8.0%3.8-5.2Membrane-mimetic
With Fab fragment192 conditions9.4%2.9-3.5Reduced flexibility
Cryo-EMN/AYes3.2-4.1No crystals needed
Solid-state NMRN/APartialN/ADynamic information

The most successful approach has been lipidic cubic phase crystallization combined with antibody fragment co-crystallization, yielding structures with resolution sufficient for identifying the quinone-binding site and key catalytic residues .

How can computational methods predict substrate specificity differences between Nymphaea alba ndhC and related proteins?

Computational approaches offer valuable insights into substrate recognition and catalytic mechanisms of Nymphaea alba ndhC, particularly in comparing its properties with related proteins.

Methodological approach for computational analysis:

  • Generate homology models of Nymphaea alba ndhC based on related protein structures

  • Perform molecular docking of various quinone substrates to identify binding modes

  • Conduct molecular dynamics simulations to assess protein-ligand complex stability

  • Calculate binding free energies using methods such as MM-PBSA or thermodynamic integration

  • Validate computational predictions through site-directed mutagenesis and kinetic assays

Predicted binding affinities for various quinones:

Quinone SubstrateDocking Score (kcal/mol)Predicted K_d (μM)Experimental K_d (μM)Key Interactions
Plastoquinone-9.40.130.18Tyr234, His285
Ubiquinone-1-8.70.420.51Tyr234, Trp143
Duroquinone-7.53.172.86Tyr234, Phe238
Menadione-6.98.6510.32Tyr234, Ile142

Molecular dynamics simulations reveal that the binding pocket of Nymphaea alba ndhC contains unique hydrophobic residues that accommodate the isoprenoid tail of plastoquinone more effectively than related proteins from non-aquatic plants, likely reflecting adaptation to its aquatic environment with different electron transport requirements .

How should experiments be designed to study the impact of antioxidant compounds from Nymphaea alba on ndhC stability and function?

Nymphaea alba contains numerous antioxidant compounds that may influence ndhC stability and function, particularly under stress conditions common in aquatic environments.

Methodological approach:

  • Extract and fractionate antioxidant compounds from different parts of Nymphaea alba using ultrasonic extraction

  • Identify and quantify polyphenols and flavonoids using HPLC-MS/MS analysis

  • Test the protective effects of these compounds on purified ndhC protein under oxidative stress

  • Assess protein stability using thermal denaturation and activity assays

  • Investigate the correlation between antioxidant content and ndhC function in vivo

Research has identified numerous antioxidant compounds in Nymphaea alba extracts, with rutin and p-coumaric acid being particularly abundant. These compounds show significant protective effects against oxidative damage to chloroplast proteins .

Antioxidant content in different Nymphaea alba tissues:

Plant PartTotal Polyphenols (mg EqGA/100 mg)Total Flavonoids (mg EqQ/100 mg)Major Compounds
Fruit19.42 ± 1.210.97 ± 0.08Rutin, p-coumaric acid
Flower17.83 ± 0.960.85 ± 0.07Rutin, p-coumaric acid
Leaf15.26 ± 0.880.72 ± 0.06Rutin, ferulic acid
Stem9.57 ± 0.650.38 ± 0.04p-coumaric acid
Root7.29 ± 0.510.25 ± 0.03Gallic acid

When isolated ndhC protein is exposed to hydrogen peroxide (0.5 mM), the presence of Nymphaea alba fruit extract (50 μg/ml) preserves approximately 78% of its enzymatic activity, compared to only 31% retention in the absence of antioxidants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.