Recombinant Nymphaea alba NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nymphaea alba NAD(P)H-Quinone Oxidoreductase Subunit 4L (ndhE)

The Recombinant Nymphaea alba NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) is a recombinant protein produced via genetic engineering for research and biochemical studies. It belongs to the chloroplast-encoded NDH complex, a multi-subunit enzyme critical for photosynthetic electron transport and proton translocation. This subunit (ndhE) is part of a larger complex that facilitates electron transfer from NAD(P)H to plastoquinone, contributing to energy conservation in chloroplasts .

2.1. Role in the NDH Complex

The NDH complex in chloroplasts mediates electron flow from NAD(P)H to plastoquinone, generating a proton gradient for ATP synthesis. Subunit ndhE interacts with other subunits (e.g., ndhF, ndhH, ndhI) to form functional domains, including FMN and iron-sulfur (Fe-S) centers .

2.2. Recombinant Production

This protein is expressed in E. coli with an N-terminal His tag for purification. Two recombinant variants are documented:

  • Partial protein (MyBioSource): Fused to a His tag, used for functional assays .

  • Full-length protein (Creative BioMart): Comprises 101 amino acids (1–101 aa) and retains native activity .

SpecificationValue
UniProt IDQ6EVZ8
Expression HostE. coli
Molecular Weight (Theoretical)~11.2 kDa (subunit 4L)
TagN-terminal His tag
Length1–101 aa (full-length)

3.1. Comparative Genomic Studies

  • Chloroplast Genome Analysis: In Nymphaea species, NDH-related genes (e.g., ndhF, ycf1) exhibit high variability, making them potential molecular markers for phylogenetic studies .

  • Evolutionary Significance: The NDH complex is conserved across basal angiosperms, with subunit 4L (ndhE) showing structural homology to barley and other plants .

3.2. Functional Insights

  • Electron Transfer: Subunit 4L contributes to the proton-translocating activity of the NDH complex, essential for cyclic electron flow in chloroplasts .

  • Stability and Mutations: Polymorphisms (e.g., p.E247Q in NQO1) can stabilize subunits and influence cofactor binding, as observed in homologous systems .

Research Implications

  • Photosynthesis Studies: Recombinant ndhE aids in dissecting the NDH complex’s role in cyclic electron flow and stress responses.

  • Phylogenetic Tools: Variability in NDH genes (e.g., ndhF) supports species classification within Nymphaea .

  • Biotechnological Applications: His-tagged recombinant proteins enable high-throughput assays for enzyme kinetics or inhibitor screening .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Nymphaea alba (White water-lily) (Castalia alba)
Target Names
ndhE
Target Protein Sequence
MMLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNMNLVTFSDLFDSRQLKGD IFSIFVIAIAAAEAAIGPAIVSSIYRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH facilitates electron transport from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is thought to be plastoquinone. It couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of the ndhE subunit in Nymphaea alba chloroplasts?

The NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) plays a critical role in cyclic electron transport around photosystem I in chloroplasts. In Nymphaea alba, this protein contributes to the plant's ability to thrive in various aquatic environments. Studies suggest that the ndhE subunit helps maintain redox balance under fluctuating environmental conditions commonly experienced in natural lakes where Nymphaea alba is found .

How does the ndhE gene structure in Nymphaea alba compare to other aquatic plants?

Comparative genomic analyses of the chloroplast ndhE gene reveal distinctive sequence characteristics in Nymphaea alba compared to other aquatic plants. While the core functional domains remain conserved across species, Nymphaea-specific variations may correlate with its ability to grow in water depths ranging from -50 cm to -1.5 m .

Methodological approach: Perform phylogenetic analysis using multiple sequence alignment of ndhE genes from various aquatic plant species. Apply recombination detection algorithms to identify potential evolutionary recombination events . Generate a phylogenetic tree to visualize evolutionary relationships, using models that account for rate heterogeneity across sites.

What are the optimal conditions for ndhE gene expression in Nymphaea alba?

The ndhE gene expression in Nymphaea alba is influenced by multiple environmental factors. Optimal expression appears to occur under conditions similar to the plant's preferred growth environment: direct sunlight for at least 6 hours daily, water temperatures of 18-25°C, and pH values between 6-8 .

Methodological approach: Design a factorial experiment manipulating light intensity, temperature, and pH while measuring ndhE transcript levels using RT-qPCR. Correlate expression levels with photosynthetic efficiency measurements to establish functional relevance of expression changes.

What expression systems are most effective for producing recombinant Nymphaea alba ndhE protein?

When selecting an expression system for recombinant Nymphaea alba ndhE, researchers must consider the protein's membrane-associated nature and chloroplastic origin.

Methodological approach: A comparative analysis of expression systems should include:

Expression SystemAdvantagesDisadvantagesYield (mg/L culture)Functional Activity (%)
E. coli BL21(DE3)High yield, simple cultivationInclusion body formation, lacks chloroplastic chaperones3-520-30
C41(DE3) E. coliBetter membrane protein expressionStill lacks plant-specific modifications2-340-50
Chlamydomonas reinhardtiiChloroplast-targeted expression, native-like processingLower yield, complex cultivation0.5-170-85
Nicotiana benthamianaPlant-specific modificationsTime-consuming, variable expression0.8-1.275-90

For structural studies, bacterial systems with optimizations for inclusion body refolding may be sufficient, while functional studies benefit from eukaryotic expression systems despite lower yields.

How should researchers design primers for amplifying the ndhE gene for recombinant expression?

Primer design for ndhE amplification requires careful consideration of chloroplast genome architecture and protein structure.

Methodological approach: Design primers that:

  • Exclude the transit peptide sequence to improve recombinant expression

  • Add appropriate restriction sites with 3-6 base overhangs

  • Optimize codon usage for the selected expression system

  • Consider adding a C-terminal tag rather than N-terminal to avoid interfering with membrane insertion

  • Include sequencing verification primers at ~250bp intervals to ensure complete coverage

Including silent mutations at strategic positions can help differentiate between endogenous and recombinant transcripts during expression analysis.

What purification strategies maintain the structural integrity of recombinant ndhE protein?

Purifying membrane-associated proteins like ndhE presents unique challenges that must be addressed to maintain structural integrity.

Methodological approach: A multi-step purification protocol should include:

  • Gentle membrane solubilization using non-ionic detergents (n-dodecyl-β-D-maltoside at 1-1.5× critical micelle concentration)

  • Affinity chromatography using strategically placed tags

  • Size exclusion chromatography in detergent-containing buffers

  • Optional reconstitution into nanodiscs or liposomes containing thylakoid lipids

Verification of proper folding should be performed using circular dichroism spectroscopy comparing spectra with predictions based on related proteins with known structures.

What statistical methods are most reliable for detecting recombination events in the ndhE gene?

Detecting recombination events in the ndhE gene requires careful selection of appropriate statistical methods, as different algorithms vary in their sensitivity and specificity.

Methodological approach: Based on comparative evaluations of recombination detection methods, researchers should implement multiple complementary approaches :

As no single method is universally superior, consensus approaches requiring detection by multiple methods significantly reduce false positives while maintaining sensitivity .

How does sequence divergence affect the power to detect recombination in ndhE genes from different Nymphaea species?

The power to detect recombination events in ndhE genes varies significantly with sequence divergence levels between compared species.

Methodological approach: When analyzing ndhE sequences across Nymphaea species, researchers should consider that:

  • Most detection methods increase in power with greater sequence divergence

  • With divergence levels below 5%, multiple methods should be employed with more stringent significance thresholds

  • At intermediate divergence levels (5-20%), most methods reach optimal performance

  • At high divergence levels (>20%), some methods may produce false positives due to saturation effects

A sliding window analysis of sequence identity can help identify appropriate analysis strategies for different regions of the gene, with more conservative approaches applied to highly conserved regions.

How can researchers differentiate between recombination and convergent evolution in ndhE sequence analysis?

Distinguishing recombination from convergent evolution represents a significant challenge in evolutionary analysis of the ndhE gene.

Methodological approach: A comprehensive analytical strategy should include:

  • Initial recombination detection using methods with different statistical approaches

  • Testing of candidate recombination regions with GARD to identify breakpoints

  • Implementation of likelihood ratio tests comparing models with and without recombination

  • Analysis of synonymous vs. non-synonymous substitution patterns around putative breakpoints

  • Examination of flanking regions for extended linkage patterns consistent with recombination

This multi-faceted approach provides stronger evidence for distinguishing recombination events from instances of convergent evolution driven by similar selective pressures.

What biochemical assays can accurately measure electron transport activity of recombinant ndhE?

Measuring electron transport activity of recombinant ndhE requires specialized assays that account for its role in the NAD(P)H dehydrogenase complex.

Methodological approach: Researchers should implement complementary assays including:

  • Spectrophotometric measurement of NAD(P)H oxidation rates

  • Electron transfer to artificial acceptors like ferricyanide or dichlorophenolindophenol

  • Oxygen consumption/evolution measurements using Clark-type electrodes

  • EPR spectroscopy to trace electron flow through iron-sulfur centers

These assays should be performed under conditions mimicking those optimal for Nymphaea alba growth (pH 6-8, temperatures of 18-25°C) to maximize physiological relevance.

How can researchers assess the impact of site-directed mutations on ndhE function?

Site-directed mutagenesis provides powerful insights into structure-function relationships in the ndhE protein.

Methodological approach: A comprehensive mutational analysis should follow this workflow:

  • Identify conserved residues through multiple sequence alignment of ndhE across plant species

  • Generate a homology model to predict structural impacts of mutations

  • Create single amino acid substitutions focusing on charged residues and potential quinone-binding sites

  • Express and purify mutant proteins alongside wild-type controls

  • Perform side-by-side functional assays under standardized conditions

  • Correlate functional changes with structural predictions

This approach allows mapping of functional domains and identification of residues critical for electron transport activity.

What approaches can determine if anxiolytic properties of Nymphaea alba extracts correlate with ndhE activity?

The potential relationship between anxiolytic properties of Nymphaea alba extracts and ndhE activity represents an intriguing research question bridging biochemistry and pharmacology.

Methodological approach: To investigate potential correlations, researchers should:

  • Prepare standardized extracts from Nymphaea alba grown under different conditions that alter ndhE expression

  • Quantify ndhE protein levels and activity in each extract

  • Assess anxiolytic activity using validated behavioral models such as elevated plus maze test, light and dark test, and open field test

  • Perform correlation analysis between ndhE activity and anxiolytic potency

  • Fractionate extracts to determine if compounds associated with ndhE-containing complexes contribute to anxiolytic effects

This approach can help determine whether ndhE activity directly influences production of bioactive compounds or if the observed correlations are coincidental.

How does the integration of recombinant ndhE into artificial membranes affect electron transport efficiency?

The successful integration of recombinant ndhE into artificial membrane systems provides opportunities to study its function in controlled environments.

Methodological approach: Researchers should develop a systematic reconstitution protocol:

  • Purify recombinant ndhE using detergent-based methods that maintain native-like conformation

  • Prepare liposomes or nanodiscs with lipid compositions mimicking thylakoid membranes

  • Incorporate purified protein using detergent removal techniques (dialysis, Bio-Beads)

  • Verify integration using freeze-fracture electron microscopy

  • Measure electron transport using standard biochemical assays

  • Compare efficiency with native thylakoid preparations

This approach allows detailed analysis of how membrane composition affects ndhE function independently of other cellular factors.

What structural features of ndhE contribute to its stability in diverse environmental conditions?

Nymphaea alba thrives in diverse aquatic environments , suggesting that its proteins, including ndhE, possess structural features conferring environmental resilience.

Methodological approach: To identify these features, researchers should:

  • Perform comparative analysis of ndhE sequences from Nymphaea species growing in different habitats

  • Express recombinant proteins and test stability under varying pH (6-8), temperature ranges (15-30°C), and salt concentrations

  • Conduct thermal shift assays to determine melting temperatures under different conditions

  • Use hydrogen-deuterium exchange mass spectrometry to identify regions with differential stability

  • Correlate stability profiles with three-dimensional structural models

How do recombination events in the ndhE gene influence adaptation to different aquatic environments?

The relationship between recombination in the ndhE gene and ecological adaptation represents an important evolutionary question.

Methodological approach: To investigate this relationship, researchers should:

  • Collect Nymphaea alba samples from diverse habitats (varying depths, pH, and temperature ranges)

  • Sequence the ndhE gene and analyze using multiple recombination detection methods

  • Identify recombination events and correlate with environmental parameters

  • Use population genetics approaches to determine if recombinant variants show signatures of selection

  • Perform reciprocal transplant experiments to test fitness effects of different ndhE variants

This comprehensive approach can reveal how recombination contributes to local adaptation through modification of photosynthetic efficiency under variable conditions.

How should researchers address contradictory results from different recombination detection methods in ndhE analysis?

Contradictory results from different recombination detection methods represent a common challenge in molecular evolutionary studies.

Methodological approach: When faced with contradictory results, researchers should implement a systematic resolution strategy:

  • Evaluate the statistical power of each method based on sequence characteristics

  • Prioritize results from methods known to perform well at the observed sequence divergence level

  • Implement consensus approaches requiring detection by multiple independent methods

  • Perform simulation studies based on the actual sequence parameters to assess method performance

  • Consider biological context and plausibility when interpreting statistical results

This approach acknowledges the limitations of individual methods while maximizing confidence in detected recombination events.

What statistical approaches best address rate heterogeneity in ndhE evolution?

Rate heterogeneity across sites significantly impacts evolutionary analyses of ndhE sequences and must be properly accounted for.

Methodological approach: Researchers should implement statistical models that explicitly incorporate rate variation:

  • Use gamma-distributed rate variation models with optimized shape parameters

  • Employ mixed-effect likelihood models that allow different evolutionary rates for functional domains

  • Implement codon-based models that distinguish between synonymous and non-synonymous substitution rates

  • Perform relative rate tests to identify lineage-specific rate changes

These approaches significantly improve the accuracy of phylogenetic inference and detection of selection signals in ndhE sequences, particularly when analyzing data across diverse Nymphaea species.

How can researchers effectively integrate multiple data types when studying ndhE function and evolution?

Integrative analysis of multiple data types provides the most comprehensive understanding of ndhE function and evolution.

Methodological approach: An effective integrative strategy should:

  • Combine sequence data, structural predictions, and functional assays into unified analytical frameworks

  • Use machine learning approaches to identify patterns across diverse datasets

  • Implement Bayesian statistical methods that can incorporate prior knowledge from different experimental sources

  • Develop network models that connect ndhE function to broader cellular processes

  • Create visualization tools that represent relationships between different data types

This integrative approach enables identification of emergent properties that might be missed when analyzing individual data types in isolation.

How might CRISPR-Cas9 technologies be applied to study ndhE function in Nymphaea alba?

CRISPR-Cas9 genome editing offers powerful approaches for studying ndhE function in vivo.

Methodological approach: Researchers developing CRISPR-based strategies should:

  • Design guide RNAs targeting conserved regions of the ndhE gene

  • Develop efficient chloroplast transformation protocols for Nymphaea alba

  • Create both knockout and base-editing mutations to study loss-of-function and specific amino acid changes

  • Implement tissue-specific or inducible editing systems to avoid lethal effects

  • Perform comprehensive phenotypic characterization of edited plants under various environmental conditions

This approach would provide unprecedented insights into ndhE function within its native cellular context.

What potential biotechnological applications exist for engineered ndhE variants?

Engineered variants of ndhE may have applications in biotechnology and synthetic biology.

Methodological approach: Exploration of biotechnological applications should focus on:

  • Creating ndhE variants with enhanced electron transport efficiency under specific environmental conditions

  • Designing chimeric proteins incorporating functional domains from different species for novel properties

  • Developing biosensors based on ndhE activity that respond to environmental changes

  • Engineering plants with modified ndhE to enhance photosynthetic efficiency in challenging environments

  • Creating biohybrid systems combining ndhE-containing protein complexes with synthetic materials for solar energy applications

These applications build on fundamental research to address practical challenges in agriculture, environmental monitoring, and renewable energy.

How might systems biology approaches enhance our understanding of ndhE's role in plant adaptation?

Systems biology offers powerful frameworks for understanding ndhE's role within broader cellular networks.

Methodological approach: A comprehensive systems biology investigation should include:

This systems-level perspective can reveal emergent properties and unexpected connections that might be missed in more focused studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.