Recombinant Nymphaea alba NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Biological Role in Chloroplast Electron Transport

The ndhG subunit belongs to the chloroplast NDH complex, a homolog of bacterial NDH-1 and mitochondrial complex I . Its primary roles include:

  • Electron Transport: Facilitates electron transfer from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers, contributing to cyclic electron transport and ATP synthesis .

  • Proton Translocation: Coupled redox reactions generate a proton gradient across the thylakoid membrane, critical for photophosphorylation .

  • Chlororespiration: Supports nighttime electron transport linked to chloroplast respiration .

The NDH complex is structurally L-shaped and comprises plastid-encoded subunits (NdhA–K) and nuclear-encoded subunits (NdhL–O) . ndhG is part of the membrane subcomplex, which anchors the complex to the thylakoid membrane and houses redox-active cofactors .

3.1. Subunit Interactions

ndhG interacts with other plastid-encoded subunits (e.g., NdhA–G) to form the core membrane subcomplex. This subcomplex is essential for binding FMN and Fe-S clusters, which mediate electron transfer . In Arabidopsis, the NDH complex exists as monomers (~550 kDa) or dimers (~1,000–1,100 kDa), with ndhG contributing to stability .

3.2. Evolutionary Conservation

ndhG is conserved across plants and cyanobacteria, reflecting its ancestral origin in endosymbiotic bacteria. In orchids, ndh genes are frequently truncated or transferred to mitochondrial genomes, but ndhG remains critical in species retaining functional chloroplast NDH complexes .

Research Applications and Tools

The recombinant ndhG protein serves as a model for studying:

  • Enzyme Assembly: Disassembly into subcomplexes (e.g., 300 and 250 kDa fragments) under detergent solubilization reveals assembly intermediates .

  • Redox Activity: In vitro assays can assess NAD(P)H-dependent quinone reduction and proton pumping efficiency.

  • Protein-Protein Interactions: Co-immunoprecipitation or crosslinking studies to map interactions with nuclear-encoded subunits (e.g., NdhL–O) .

Key Research Findings

  • Structural Dynamics: Electron microscopy of cyanobacterial NDH-1 revealed an L-shaped architecture, providing a template for plant NDH complex models .

  • Functional Redundancy: While ndhG is plastid-encoded, nuclear-encoded subunits (e.g., NdhL–O) are required for activity, highlighting evolutionary specialization .

  • Gene Transfer Events: In orchids, ndh gene fragments, including ndhG, are occasionally translocated to mitochondrial genomes, though functional significance remains unclear .

Limitations and Future Directions

While the recombinant ndhG enables biochemical studies, challenges persist:

  • Low Solubility: Plastid-encoded subunits often require chaperones (e.g., Cpn60β4) for proper folding .

  • Limited Structural Data: No high-resolution crystal structures of plant NDH complexes exist, necessitating homology modeling based on bacterial NDH-1 .

Future studies could leverage cryo-EM to resolve the plant NDH complex structure, leveraging recombinant subunits like ndhG.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Nymphaea alba (White water-lily) (Castalia alba)
Target Names
ndhG
Target Protein Sequence
MDLPAPIHDILLVSLGSGLIVGGLGVVLLTNPIYSAFSLGLVLVCISLFYIPSNSYFVAA AQLLIYVGAINVLILFAVMFMNGSEYYNYFHFWTVGDGFTSLVCTSIFFSLIATIPNTSW YGIIWTTRSNQIIEQDLTSNVQQIGIHLSTDFYLPFELISIILLVSLVGAIAMARRE
Uniprot No.

Target Background

Function
NDH facilitates electron transport from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. The primary electron acceptor for the enzyme in this species is believed to be plastoquinone. This process couples the redox reaction to proton translocation, conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) and what role does it play in Nymphaea alba?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) is a chloroplastic protein that functions as a component of the NADH dehydrogenase-like (NDH) complex in the chloroplast electron transport chain. In Nymphaea alba, as in other plants, this protein participates in cyclic electron flow around photosystem I, contributing to ATP synthesis without NADPH production. The enzyme helps the plant adapt to varying environmental conditions by balancing the ATP/NADPH ratio and protecting against photo-oxidative damage . Nymphaea alba's aquatic habitat may influence the specific characteristics and expression patterns of this protein compared to terrestrial plants.

How does ndhG from Nymphaea alba compare structurally to similar proteins in other plant species?

While specific structural data for Nymphaea alba ndhG is limited, comparative analysis with similar proteins from other plant species suggests conservation of key functional domains. The ndhG protein typically contains transmembrane domains that anchor it within the thylakoid membrane of chloroplasts. Based on comparative genomics, Nymphaea alba ndhG likely contains similar secondary structure elements to those found in other aquatic and terrestrial plants, though with potential adaptations reflecting its aquatic environment . The protein would be expected to maintain structural homology with other species while potentially exhibiting unique amino acid substitutions that influence its efficiency in aquatic conditions.

What extraction and purification methods are recommended for isolating native ndhG from Nymphaea alba tissues?

For isolating native ndhG protein from Nymphaea alba tissues:

  • Tissue selection: Young leaves yield better results due to higher photosynthetic activity .

  • Homogenization: Grind fresh tissue in extraction buffer (50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM EDTA, 10% glycerol) with protease inhibitors at 4°C.

  • Differential centrifugation: Isolate chloroplasts through sequential centrifugation (1,000×g for 10 min, then 10,000×g for 15 min).

  • Membrane solubilization: Treat chloroplast pellet with 1% n-dodecyl β-D-maltoside.

  • Chromatography: Use ion exchange followed by size exclusion chromatography.

  • Verification: Confirm identity by Western blotting with anti-ndhG antibodies and mass spectrometry.

This protocol can be optimized based on the specific characteristics of Nymphaea alba chloroplast membranes .

What expression systems are most suitable for producing recombinant Nymphaea alba ndhG?

Based on available information on chloroplastic proteins, the following expression systems are recommended for recombinant Nymphaea alba ndhG production:

Expression SystemAdvantagesLimitationsOptimization Tips
E. coli (BL21-DE3)High yield, simple cultivation, cost-effectivePotential for inclusion bodies, lack of post-translational modificationsUse lower induction temperature (16-18°C), codon-optimized sequence, fusion tags (MBP or SUMO)
Chlamydomonas reinhardtiiChloroplast-specific machinery, proper folding environmentLower yield than bacterial systemsUse endogenous promoters, optimize codon usage for algal expression
Nicotiana benthamiana (transient)Plant-specific post-translational modifications, membrane protein expression capabilityTime-consuming compared to bacterial systemsUse chloroplast transit peptide, optimize infiltration conditions

E. coli appears to be the preferred initial system, similar to the production of related recombinant proteins like the one described in search result .

What methodological approaches can resolve contradictory findings regarding ndhG activity in different Nymphaea alba populations?

To resolve contradictory findings regarding ndhG activity across different Nymphaea alba populations:

  • Standardized sampling: Collect samples from various populations with detailed recording of geographical coordinates, water conditions (pH, temperature, mineral content), and phenological stage.

  • Multi-level analysis:

    • Genomic level: Sequence the ndhG gene from multiple populations to identify polymorphisms.

    • Transcriptomic level: Quantify expression using RT-qPCR with carefully selected reference genes.

    • Proteomic level: Perform western blots and activity assays under standardized conditions.

    • Metabolomic level: Correlate activity with downstream metabolite profiles.

  • Environmental parameters correlation: Use principal component analysis to identify environmental variables influencing activity.

  • Controlled greenhouse experiments: Grow plants from different populations under identical conditions to distinguish genetic from environmental factors.

  • Cross-validation: Employ multiple activity assay methods (spectrophotometric, polarographic, fluorescence-based) to confirm findings .

This comprehensive approach can elucidate whether variations stem from genetic differences, environmental adaptations, or methodological inconsistencies.

How do the antioxidant properties of Nymphaea alba extracts correlate with ndhG expression and activity?

The correlation between Nymphaea alba's antioxidant properties and ndhG expression requires investigation through:

  • Tissue-specific analysis: Compare ndhG expression levels across different plant parts (leaves, flowers, stems, roots) using RT-qPCR, with parallel quantification of antioxidant compounds including polyphenols (19.42 mg EqGA/100 mg extract) and flavonoids (0.97 mg EqQ/100 mg extract) as reported in previous studies .

  • Stress response experiments: Subject plants to oxidative stress conditions (high light, drought, temperature extremes) and measure both ndhG expression and antioxidant compound production.

  • Mechanistic pathway analysis: Investigate whether:

    • Enhanced cyclic electron flow through ndhG activity reduces ROS production

    • ndhG activity influences the expression of genes involved in antioxidant compound synthesis

    • Specific antioxidant compounds (rutin and p-coumaric acid, identified as major components) interact directly with the NDH complex

  • Comparative analysis with ndhG mutants: Using gene editing techniques, create plants with altered ndhG expression and measure changes in antioxidant profiles.

This integrated approach would reveal whether the established antioxidant properties of Nymphaea alba are directly linked to ndhG function or represent parallel adaptive mechanisms .

What are the optimal conditions for assaying recombinant Nymphaea alba ndhG enzymatic activity in vitro?

For optimal assaying of recombinant Nymphaea alba ndhG enzymatic activity in vitro:

ParameterOptimal ConditionJustification
Buffer composition50 mM Tris-HCl (pH 7.8), 10 mM MgCl₂, 2.5 mM CaCl₂Maintains protein stability while providing necessary cofactors
Temperature25°CReflects natural aquatic environment of Nymphaea alba
Electron donorNADH (2 mM) or NADPH (2 mM)Test both to determine preference
Electron acceptorUbiquinone-1 or plastoquinone analogs (100 μM)Physiologically relevant electron acceptors
Detection methodSpectrophotometric (340 nm) for NAD(P)H oxidationDirect measurement of primary reaction
Alternative detectionDichlorophenolindophenol (DCPIP) reduction (600 nm)Higher sensitivity for low activity samples
ControlsHeat-inactivated enzyme, no-substrate controlsEssential to determine background rates

Activity measurements should be conducted under varying light conditions (dark vs. illuminated) to assess light-dependent regulation. Additionally, assays should include comparison with related proteins from other species to benchmark activity levels .

How can researchers differentiate between genuine ndhG activity and contaminating NAD(P)H oxidase activities in purified enzyme preparations?

Differentiating genuine ndhG activity from contaminating NAD(P)H oxidase activities requires multiple experimental approaches:

  • Inhibitor profiling:

    • ndhG activity: Sensitive to rotenone (complex I inhibitor) and antimycin A (inhibits electron transport)

    • NAD(P)H oxidases: Sensitive to diphenyleneiodonium (DPI) but not rotenone

    • Compare inhibition patterns between your preparation and known controls

  • Substrate specificity analysis:

    • Test activity with different quinone analogs (plastoquinone, ubiquinone, duroquinone)

    • ndhG typically shows preference for plastoquinone derivatives

    • Calculate Km values for different substrates to establish kinetic fingerprints

  • Immunodepletion:

    • Use specific antibodies against ndhG to deplete it from preparations

    • Measure residual activity to quantify contaminating oxidases

  • Protein complex analysis:

    • Perform blue native PAGE to separate intact complexes

    • Conduct in-gel activity assays to localize NAD(P)H dehydrogenase activity

    • Verify subunit composition by subsequent 2D SDS-PAGE or mass spectrometry

  • Reconstitution experiments:

    • Express and purify individual subunits

    • Systematically reconstitute the complex to verify activity dependencies

These approaches collectively provide a robust differentiation strategy that accounts for potential overlapping activities in complex preparations .

What bioinformatic approaches can predict the impact of genetic variations in ndhG sequences from different Nymphaea alba populations?

To predict the impact of genetic variations in ndhG sequences from different Nymphaea alba populations, the following bioinformatic workflow is recommended:

  • Sequence alignment and conservation analysis:

    • Multiple sequence alignment of ndhG sequences from different populations

    • Calculation of conservation scores to identify invariant residues

    • Comparison with ndhG sequences from related species to establish evolutionary constraints

  • Structural modeling and variant impact prediction:

    • Homology modeling based on available crystal structures of related NDH complex components

    • Molecular dynamics simulations to assess conformational impacts of variants

    • In silico mutagenesis and energy minimization to predict stability changes

  • Functional domain analysis:

    • Identification of functional motifs using Pfam, PROSITE, and other databases

    • Mapping variants to known functional regions (substrate binding, protein-protein interaction)

    • Predicting transmembrane regions and assessing if variants alter membrane topology

  • Population genetics metrics:

    • Calculate FST values to measure population differentiation

    • Identify signatures of selection using dN/dS ratios

    • Conduct linkage disequilibrium analysis to detect co-evolving residues

  • Integration with environmental data:

    • Correlate specific variants with environmental parameters (temperature, water chemistry)

    • Employ ecological niche modeling to predict adaptive significance of variants

This comprehensive bioinformatic approach can reveal whether genetic variations are functionally neutral or represent adaptive responses to different environmental conditions .

How should researchers design experiments to elucidate the role of ndhG in Nymphaea alba's adaptation to different light intensities?

To investigate ndhG's role in Nymphaea alba's adaptation to different light intensities:

  • Experimental setup:

    • Cultivate plants under controlled conditions with at least three light intensity treatments (low: 50 μmol m⁻² s⁻¹, medium: 250 μmol m⁻² s⁻¹, high: 800 μmol m⁻² s⁻¹)

    • Maintain other environmental factors constant (temperature, nutrient availability, photoperiod)

    • Include both short-term (hours to days) and long-term (weeks) light treatments

  • Multilevel analysis framework:

    • Transcriptional: Quantify ndhG transcript abundance via RT-qPCR at different time points

    • Translational: Monitor protein levels through western blot analysis

    • Functional: Measure NDH complex activity using chlorophyll fluorescence (post-illumination fluorescence rise)

    • Physiological: Assess photosynthetic parameters (ETR, NPQ, qP) using PAM fluorometry

    • Whole-plant: Document growth rates, chlorophyll content, and morphological adaptations

  • Advanced analyses:

    • Use chloroplast isolation to measure cyclic electron flow rates in different light-acclimated plants

    • Employ RNA-seq to profile global transcriptional changes and identify co-regulated genes

    • Apply metabolomics to detect shifts in energy-related metabolites under different light conditions

  • Validation approaches:

    • CRISPR-Cas9 gene editing or RNAi to create ndhG-suppressed lines

    • Complementation with wild-type or variant ndhG to confirm functionality

    • Cross-species comparison with terrestrial plants to identify aquatic-specific adaptations

This design allows for the comprehensive characterization of ndhG's role in photosynthetic acclimation to varying light environments.

What experimental controls are essential when comparing ndhG activity between cultivated and wild Nymphaea alba specimens?

When comparing ndhG activity between cultivated and wild Nymphaea alba specimens, the following controls are essential:

  • Genetic background controls:

    • Genomic verification of species identity and potential hybridization using markers identified in previous studies

    • Genome size measurement using flow cytometry (2C-values of approximately 4.47 pg for pure N. alba, as previously reported)

    • Sequencing of the ndhG gene to identify potential genetic variations

  • Environmental condition controls:

    • Standardized cultivation conditions for ex situ comparisons (temperature, light, water chemistry)

    • Detailed documentation of in situ conditions for wild specimens (GPS coordinates, water parameters, season)

    • Age-matched plants to control for developmental stage effects

    • Similar photoperiod and light intensity during the 24-48 hours before sampling

  • Sampling controls:

    • Consistent sampling time (preferably midday) to control for diurnal variation

    • Sampling from the same leaf position and developmental stage

    • Rapid sample processing and preservation to prevent degradation

  • Methodological controls:

    • Parallel extraction and assay procedures to minimize technical variation

    • Internal reference proteins with stable expression across conditions

    • Inclusion of samples with known activity levels as inter-assay calibrators

    • Negative controls (heat-inactivated samples) and positive controls (recombinant protein)

These controls ensure that observed differences in ndhG activity are attributable to the wild versus cultivated status rather than confounding factors.

How can researchers effectively incorporate ndhG structural data into rational design of site-directed mutagenesis experiments?

To effectively incorporate structural data into rational design of site-directed mutagenesis experiments for Nymphaea alba ndhG:

  • Structural data acquisition and analysis:

    • Generate homology models based on available structures of related proteins

    • Perform molecular dynamics simulations to identify stable conformations

    • Conduct molecular docking studies with substrates (NADH/NADPH and quinones)

    • Map conserved residues across multiple species to identify functionally important regions

  • Target selection strategy:

    • Prioritize residues in the following categories:
      a) Predicted substrate binding sites
      b) Conserved residues at subunit interfaces
      c) Residues unique to aquatic plants like Nymphaea alba
      d) Potential regulatory sites (phosphorylation, redox-sensitive residues)

    • Design a mutagenesis matrix covering:
      a) Conservative substitutions (maintaining physicochemical properties)
      b) Non-conservative substitutions
      c) Alanine scanning of key regions
      d) Introduction of reporter groups (cysteine for labeling, tryptophan for fluorescence)

  • Experimental validation pipeline:

    • Expression screening to identify mutants that maintain folding/stability

    • Kinetic characterization (kcat, Km) for functional mutants

    • Thermal stability assays to assess structural integrity

    • Binding studies using isothermal titration calorimetry or surface plasmon resonance

  • Iterative refinement:

    • Consolidate experimental data to refine structural models

    • Design second-generation mutations based on initial findings

    • Consider combinatorial mutations to test functional hypotheses

This approach ensures systematic exploration of structure-function relationships while maximizing the information yield from mutagenesis experiments .

What specialized techniques are required to study the interaction between ndhG and other subunits of the NDH complex in Nymphaea alba?

Studying interactions between ndhG and other NDH complex subunits in Nymphaea alba requires specialized techniques:

  • In vivo interaction studies:

    • Split-GFP or BiFC (Bimolecular Fluorescence Complementation) in plant protoplasts

    • FRET (Förster Resonance Energy Transfer) analysis with fluorescently tagged subunits

    • In vivo crosslinking followed by immunoprecipitation to capture transient interactions

  • Protein complex isolation:

    • Blue native PAGE with subsequent Western blotting to identify co-migrating subunits

    • Sucrose gradient ultracentrifugation to separate intact complexes

    • Affinity purification using tagged ndhG as bait to pull down interacting partners

  • Direct interaction mapping:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify interaction interfaces

    • Chemical crosslinking coupled with mass spectrometry (XL-MS) to determine spatial proximity

    • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) for binding kinetics

  • Structural approaches:

    • Cryo-electron microscopy of isolated NDH complexes

    • X-ray crystallography of reconstituted subcomplexes

    • NMR analysis of labeled domains for dynamic interaction studies

  • Computational methods:

    • Molecular docking simulations between ndhG and partner subunits

    • Coevolution analysis to identify potentially interacting residues

    • Molecular dynamics simulations of subunit interfaces

These techniques provide complementary information about the assembly, dynamics, and functional interactions within the NDH complex, which can be particularly important for understanding adaptations specific to aquatic plants like Nymphaea alba .

How should researchers interpret differences in ndhG activity between different anatomical parts of Nymphaea alba?

When interpreting differences in ndhG activity across anatomical parts of Nymphaea alba:

  • Contextual interpretation framework:

    • Consider the photosynthetic capacity of each tissue (chlorophyll content, stomatal density)

    • Account for the developmental stage of each tissue (young vs. mature leaves)

    • Interpret findings in relation to the aquatic lifestyle and specialized adaptations

  • Physiological correlation analysis:

    • Compare ndhG activity with photosynthetic parameters in each tissue

    • Correlate with cyclic electron flow capacity

    • Assess relationship with photoprotection mechanisms (NPQ, antioxidant systems)

    • Consider the mineral content of different tissues, as previous studies have shown varying distributions of K, P, Na, Ca, and Mg across plant parts

  • Molecular basis exploration:

    • Determine whether activity differences result from:
      a) Differential gene expression (transcriptional regulation)
      b) Post-translational modifications (phosphorylation, redox regulation)
      c) Protein-protein interactions specific to certain tissues
      d) Membrane lipid environment variations affecting complex assembly

  • Evolutionary and ecological significance:

    • Compare tissue-specific activity patterns with terrestrial species

    • Consider how observed distribution supports adaptations to aquatic environments

    • Assess how activity distribution changes under different environmental stresses

  • Practical implications:

    • Guide optimal tissue selection for further biochemical and functional studies

    • Inform sampling protocols for comparative studies across populations

This multifaceted interpretation approach provides a comprehensive understanding of the biological significance of tissue-specific ndhG activity patterns.

What statistical approaches best address variability in recombinant ndhG activity measurements across experimental replicates?

To address variability in recombinant ndhG activity measurements:

  • Experimental design considerations:

    • Employ nested designs to capture variation at multiple levels (technical replicates, biological replicates, experimental batches)

    • Include internal standards in each assay to enable normalization

    • Implement randomization and blocking to minimize systematic biases

  • Data preprocessing:

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Apply appropriate transformations (log, square root) if necessary

    • Identify and handle outliers through standardized protocols (Grubbs' test, Dixon's Q test)

  • Variance component analysis:

    • Use mixed-effects models to partition variance sources (biological vs. technical)

    • Calculate intraclass correlation coefficients to assess repeatability

    • Implement restricted maximum likelihood (REML) estimation for unbalanced designs

  • Robust statistical methods:

    • When data remain non-normal despite transformations:
      a) Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis)
      b) Permutation tests for complex experimental designs
      c) Bootstrap confidence intervals for mean activity estimates

  • Advanced statistical approaches:

    • Bayesian hierarchical modeling to incorporate prior knowledge

    • Meta-analytical techniques to combine data across experiments

    • Power analysis to determine optimal sample sizes for future experiments

These statistical approaches provide rigorous quantification of variability sources and enable reliable interpretation of activity differences across experimental conditions .

How can researchers establish meaningful correlations between ndhG genetic variations and photosynthetic performance in Nymphaea alba populations?

To establish meaningful correlations between ndhG genetic variations and photosynthetic performance:

  • Population sampling strategy:

    • Sample multiple individuals from diverse populations (minimum 30 individuals total)

    • Include populations from different environmental conditions (flow cytometry can help verify species identity as N. alba has a mean 2C-value of 4.47 pg)

    • Document environmental parameters at each collection site

  • Genotype-phenotype correlation analysis:

    • Genotyping approaches:
      a) Sanger sequencing of the ndhG gene to identify variants
      b) SNP genotyping of key polymorphisms identified in initial screening
      c) Haplotype reconstruction to identify co-inherited variations

    • Phenotyping protocols:
      a) Chlorophyll fluorescence parameters (Fv/Fm, ETR, NPQ)
      b) Gas exchange measurements (photosynthetic rate, stomatal conductance)
      c) PSI/PSII activity ratios and cyclic electron flow quantification
      d) Stress tolerance assays (recovery from high light, temperature extremes)

  • Statistical analysis framework:

    • Association studies:
      a) General linear models with environmental covariates
      b) Mixed models accounting for population structure
      c) Multivariate approaches (canonical correlation analysis, partial least squares)

    • Causal modeling:
      a) Path analysis to test direct and indirect effects
      b) Structural equation modeling incorporating multiple traits
      c) Mediation analysis to identify intermediate phenotypes

  • Functional validation:

    • Expression of variant forms in heterologous systems

    • In vitro activity assays of purified variant proteins

    • Complementation studies in model systems

This comprehensive approach enables robust determination of which genetic variations have functional consequences for photosynthetic performance while accounting for population structure and environmental effects .

What are the most reliable biomarkers to assess the functional state of the NDH complex containing ndhG in Nymphaea alba chloroplasts?

The most reliable biomarkers for assessing NDH complex functional state in Nymphaea alba chloroplasts include:

  • Biophysical markers:

    • Post-illumination fluorescence rise (PIFR): Specifically indicates NDH-mediated cyclic electron flow

    • P700 re-reduction kinetics: Measures electron donation to PSI, partially dependent on NDH activity

    • Electrochromic shift (ECS) relaxation kinetics: Indicates thylakoid membrane energization state

    • 77K chlorophyll fluorescence emission spectra: Reveals PSI/PSII excitation balance

  • Biochemical indicators:

    • NADH/NAD+ and NADPH/NADP+ ratios in chloroplasts: Reflect electron transfer capacity

    • Plastoquinone redox state: Indicates electron flow through the NDH complex

    • ATP/ADP ratio: Reflects energetic output partially dependent on cyclic electron flow

    • Specific post-translational modifications (phosphorylation sites) on NDH subunits

  • Molecular biomarkers:

    • Expression ratios of NDH complex subunits: Indicates coordinated regulation

    • Assembly state analysis by blue native PAGE: Reveals intact complex formation

    • Protein turnover rates of ndhG: Indicates stability and regulation

    • Co-expression patterns with known interacting proteins

  • Stress-response indicators:

    • Induction kinetics under fluctuating light: NDH becomes especially important

    • Recovery from photoinhibition: Enhanced by functional NDH complex

    • ROS accumulation patterns: Modulated by NDH-mediated electron flow

These multidimensional biomarkers provide complementary information about NDH complex functionality, enabling comprehensive assessment of its contribution to photosynthetic electron transport in Nymphaea alba .

How might understanding ndhG function in Nymphaea alba contribute to improving photosynthetic efficiency in crop plants?

Understanding ndhG function in Nymphaea alba could contribute to crop improvement through:

  • Novel genetic resources for photosynthetic engineering:

    • Identification of unique adaptive features from aquatic environments

    • Discovery of structural variants with enhanced cyclic electron flow capacity

    • Characterization of regulatory mechanisms that balance linear vs. cyclic electron transport

    • Understanding how Nymphaea alba's ndhG contributes to the remarkable antioxidant properties observed in the plant (high polyphenol content of 19.42 mg EqGA/100 mg extract)

  • Translational approaches for crop improvement:

    • Targeted gene editing of crop ndhG homologs guided by Nymphaea alba insights

    • Expression of optimized ndhG variants to enhance cyclic electron flow

    • Alteration of regulatory elements controlling ndhG expression

    • Introduction of specific post-translational modification sites identified in Nymphaea alba

  • Stress tolerance enhancement strategies:

    • Improving photoprotection through optimized NDH complex function

    • Enhancing recovery from photoinhibition under field conditions

    • Increasing resilience to fluctuating light environments

    • Optimizing ATP/NADPH production ratios for varying environmental conditions

  • Methodological advances:

    • Development of high-throughput screening techniques for NDH complex activity

    • Creation of biosensors for monitoring chloroplast energetics in real-time

    • Establishment of predictive models linking NDH activity to whole-plant performance

  • Interdisciplinary applications:

    • Integration with systems biology approaches to understand complex photosynthetic networks

    • Combination with breeding programs focusing on physiological traits

    • Application in synthetic biology approaches to redesign photosynthetic machinery

These applications could lead to crops with improved photosynthetic efficiency, particularly under fluctuating or stressful environmental conditions.

What are the key considerations when designing experiments to investigate the potential role of ndhG in Nymphaea alba's adaptation to different aquatic environments?

When investigating ndhG's role in Nymphaea alba's adaptation to different aquatic environments:

  • Ecological sampling design:

    • Establish a gradient of aquatic conditions (flowing vs. stagnant, clear vs. turbid, nutrient-rich vs. nutrient-poor)

    • Sample multiple populations across geographical gradients and water chemistry profiles

    • Conduct reciprocal transplant experiments to separate genetic adaptation from phenotypic plasticity

    • Consider the known distribution patterns and genetic diversity of Nymphaea alba (previously studied through flow cytometry, revealing distinct genome size differences between species)

  • Multilevel phenotyping approach:

    • Characterize ndhG sequence variation across populations

    • Measure expression levels under native and controlled conditions

    • Assess NDH complex assembly and activity

    • Quantify whole-plant physiological responses (photosynthetic parameters, growth rates)

    • Document morphological adaptations (leaf structure, stomatal patterns)

  • Environmental parameter monitoring:

    • Water quality parameters (temperature, pH, dissolved oxygen, turbidity)

    • Light quality and quantity at different water depths

    • Seasonal variations in environmental conditions

    • Biotic interactions (competing flora, herbivory pressure)

  • Experimental manipulation strategies:

    • Ex situ common garden experiments controlling single environmental variables

    • Mesocosm studies simulating natural habitat complexity

    • Controlled stress treatments (light fluctuations, temperature variations, nutrient limitations)

    • Specific inhibition of NDH complex to assess consequences for plant performance

  • Integration with biochemical data:

    • Connect findings with known biochemical properties of Nymphaea alba, such as its high polyphenol content (19.42 mg EqGA/100 mg extract) and flavonoid content (0.97 mg EqQ/100 mg extract)

    • Consider how these compounds might interact with photosynthetic processes

This comprehensive experimental framework enables robust assessment of ndhG's contribution to adaptation across diverse aquatic environments .

How can findings from Nymphaea alba ndhG research inform our understanding of photosynthetic adaptation during plant evolution?

Nymphaea alba ndhG research can provide valuable insights into photosynthetic evolution:

  • Evolutionary context of Nymphaea alba:

    • As a basal angiosperm lineage, Nymphaeaceae provides glimpses into ancient photosynthetic adaptations

    • Aquatic lifestyle represents a derived condition among angiosperms, offering insights into re-adaptation to aquatic environments

    • Complex hybridization patterns documented between Nymphaea species (such as those between N. alba and N. candida) provide natural experiments in photosynthetic gene recombination

  • Comparative evolutionary frameworks:

    • Contrast ndhG structure and function between Nymphaea alba and:
      a) Other aquatic plants with independent aquatic adaptations
      b) Terrestrial relatives to identify aquatic-specific innovations
      c) Algal lineages to understand convergent solutions

    • Analyze selection signatures on ndhG sequences to identify adaptively important residues

    • Reconstruct ancestral sequences to understand the evolution of NDH complex function

  • Major evolutionary transitions:

    • Investigate how ndhG contributes to adaptation during:
      a) Land plant terrestrialization
      b) Secondary adaptation to aquatic environments
      c) Diversification across ecological gradients

    • Examine the relationship between ndhG and the evolution of C3/C4 photosynthesis

    • Explore potential roles in CAM photosynthesis evolution

  • Molecular evolution insights:

    • Assess rates of molecular evolution in ndhG compared to other photosynthetic genes

    • Investigate coevolution between ndhG and interacting proteins

    • Characterize lineage-specific duplications or losses

    • Identify convergent amino acid substitutions associated with specific environmental adaptations

  • Broader evolutionary implications:

    • Connect NDH complex evolution to major climatic transitions in Earth's history

    • Relate findings to the evolution of photoprotection mechanisms

    • Provide context for understanding photosynthetic gene transfer between plastid and nuclear genomes

These evolutionary perspectives can enhance our understanding of photosynthetic adaptation across plant phylogeny and ecological transitions.

What emerging technologies could revolutionize the study of ndhG and other chloroplastic proteins in Nymphaea alba?

Emerging technologies poised to revolutionize ndhG and chloroplastic protein research include:

  • Advanced imaging technologies:

    • Super-resolution microscopy for in situ visualization of protein complexes

    • Cryo-electron tomography of intact chloroplasts to capture native membrane organization

    • Label-free imaging techniques (Raman microscopy, synchrotron X-ray imaging)

    • Live-cell imaging with genetically encoded biosensors for dynamic studies

  • Single-cell and spatial omics:

    • Single-cell proteomics to capture cell-type specific variations

    • Spatial transcriptomics to map expression patterns across leaf tissues

    • MALDI-imaging mass spectrometry for protein and metabolite distribution

    • In situ proximity labeling for capturing protein interaction networks in native contexts

  • Advanced protein engineering approaches:

    • Optogenetic control of ndhG function using light-responsive domains

    • Synthetic protein scaffolds to enhance NDH complex assembly or activity

    • De novo design of optimized ndhG variants with enhanced properties

    • Protein semi-synthesis to incorporate non-canonical amino acids for mechanistic studies

  • CRISPR-based technologies:

    • Base editing for precise modification of ndhG sequence

    • Prime editing for targeted insertions or complex edits

    • CRISPR activation/interference for modulating expression

    • Chloroplast genome editing for manipulating the native genomic context

  • Computational and modeling advances:

    • AlphaFold2 and related tools for accurate protein structure prediction

    • Molecular dynamics simulations at extended timescales

    • Quantum mechanics/molecular mechanics (QM/MM) for electron transfer modeling

    • Multi-scale modeling connecting molecular events to whole-plant physiology

  • Integrated multi-omics platforms:

    • Combined proteomics, metabolomics, and phenomics approaches

    • Automated high-throughput phenotyping under controlled environmental conditions

    • Integration of field and laboratory data through advanced analytics

    • Machine learning approaches to identify patterns in complex datasets

These technologies will enable unprecedented insights into ndhG function and its integration within the photosynthetic apparatus of Nymphaea alba.

What are the most significant unresolved questions regarding ndhG function in Nymphaea alba that warrant future research?

The most significant unresolved questions regarding ndhG function in Nymphaea alba include:

  • Environmental adaptation mechanisms:

    • How does ndhG contribute to Nymphaea alba's adaptation to varying light conditions in aquatic environments?

    • What role does the NDH complex play in the plant's remarkable antioxidant capacity, given the high polyphenol content (19.42 mg EqGA/100 mg extract) and flavonoid content (0.97 mg EqQ/100 mg extract) reported in previous studies?

    • How does ndhG function change across developmental stages and different anatomical parts of the plant?

  • Molecular function and regulation:

    • What are the precise electron transfer pathways involving ndhG in Nymphaea alba chloroplasts?

    • How is ndhG expression and activity regulated in response to environmental stressors?

    • What post-translational modifications modulate ndhG function in this species?

    • How does the protein interact with other components of the photosynthetic apparatus?

  • Evolutionary aspects:

    • How has ndhG evolved in Nymphaea alba compared to terrestrial plants?

    • What unique adaptations are present in the ndhG sequence of Nymphaea alba that reflect its aquatic lifestyle?

    • How do hybridization events, such as those documented between Nymphaea species , impact ndhG function?

  • Biotechnological potential:

    • Can insights from Nymphaea alba ndhG be translated to improve crop photosynthetic efficiency?

    • What unique properties might make this aquatic plant's ndhG valuable for engineering enhanced photosynthesis?

    • How might understanding ndhG function contribute to conservation efforts for aquatic ecosystems?

  • Methodological challenges:

    • What are the most effective approaches for studying membrane protein complexes in aquatic plants?

    • How can we better integrate molecular and physiological data to understand ndhG's role in whole-plant performance?

    • What species-specific tools need to be developed to advance Nymphaea alba as a research system?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.