Recombinant Nymphaea alba Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Significance in Photosystem II

CP47 is a core antenna protein in PSII, facilitating energy transfer to the reaction center and stabilizing the oxygen-evolving complex (OEC). Key functional roles include:

  • Chlorophyll Binding: Binds 16 chlorophyll a molecules and 4 β-carotenes, forming the inner antenna system .

  • PSII Assembly: Essential for the integration of D1/D2 reaction center proteins and subsequent recruitment of OEC subunits .

  • Structural Stability: Interacts with PsbH, PsbL, and PsbT to maintain PSII integrity .

Mutational studies in Arabidopsis and Synechocystis demonstrate that CP47 deficiency disrupts PSII assembly, leading to photoautotrophic growth defects .

Biotechnological Applications

Recombinant CP47 is widely used in:

  • In Vitro PSII Reconstitution: Studying chlorophyll-protein interactions and electron transport kinetics .

  • Antibody Production: Generating antibodies for immunoblotting and localization studies .

  • Structural Biology: Facilitating cryo-EM and X-ray crystallography of PSII subcomplexes .

Comparative Analysis with Orthologs

SpeciesSequence IdentityFunctional Notes
Populus alba ~95%Conserved chlorophyll-binding residues; used in evolutionary studies of PSII.
Oenothera glazioviana ~92%Structural variations in transmembrane helices may affect chlorophyll affinity.
Synechocystis sp. PCC 6803 ~85%Lacks PsbH interaction in prokaryotes; used to study PSII evolution.

Research Findings

  • Assembly Intermediates: CP47 forms preassembled complexes with PsbH and PsbT in Synechocystis before integrating into PSII .

  • Stress Responses: Under high-light stress, CP47 detaches from damaged PSII cores and requires HCF107 for RNA processing in chloroplasts .

  • Chlorophyll Biosynthesis: Psb28, a cyanobacterial assembly factor, stabilizes CP47 synthesis and chlorophyll cyclization .

Future Directions

  • Mechanistic Studies: Elucidate CP47’s role in OEC stabilization using recombinant protein mutants.

  • Biomimetic Systems: Engineer artificial photosynthetic systems leveraging CP47’s light-harvesting efficiency .

  • Evolutionary Analysis: Compare CP47 sequences across basal angiosperms (e.g., Nymphaea, Amborella) to trace PSII adaptation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Nymphaea alba (White water-lily) (Castalia alba)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPSWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKALRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVNAGLAENLSLSE SWSKIPDKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGHELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELDGVSYNDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function
CP47, a key component of the photosystem II (PSII) core complex, plays a crucial role in chlorophyll binding and catalyzing the primary light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O. This process generates O2 and a proton gradient, which is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Nymphaea alba Photosystem II CP47 chlorophyll apoprotein?

Nymphaea alba Photosystem II CP47 chlorophyll apoprotein (psbB) is an integral membrane protein component of Photosystem II (PSII) in the European White Water Lily (Nymphaea alba). Structurally similar to other plant species' CP47 proteins, it consists of approximately 508 amino acids and functions as one of the core antenna proteins in PSII. The protein contains multiple transmembrane helices and binds several chlorophyll molecules that participate in light harvesting and excitation energy transfer to the reaction center .

The protein features conserved histidine residues that coordinate chlorophyll molecules and contains regions responsible for binding to other PSII subunits. Based on homology with other species, the protein likely has six transmembrane domains with both N- and C-termini located on the stromal side of the thylakoid membrane .

How does the psbB protein from Nymphaea alba compare with other aquatic plant species?

The CP47 protein (psbB) in Nymphaea alba shares significant sequence homology with those from other aquatic plants, particularly with other water lilies and related species. While specific research on Nymphaea alba psbB is limited, comparative analysis with other aquatic plants reveals conservation of key functional domains involved in chlorophyll binding and energy transfer .

What are the expression challenges specific to recombinant Nymphaea alba psbB production?

Recombinant production of Nymphaea alba psbB presents several technical challenges:

  • Membrane protein expression difficulties: As an integral membrane protein, psbB is hydrophobic and often toxic to expression hosts when overproduced.

  • Chlorophyll incorporation: The native protein binds chlorophyll molecules essential for its function, but heterologous expression systems like E. coli do not produce chlorophyll naturally.

  • Proper folding concerns: The complex transmembrane topology requires specialized expression systems and careful optimization of induction conditions.

  • Codon optimization requirements: The plant codon usage differs from bacterial expression systems, necessitating codon optimization for efficient expression .

Researchers have addressed these challenges through strategies such as fusion with solubility-enhancing tags (like His-tags), expression in specialized E. coli strains designed for membrane proteins, and careful optimization of expression temperatures and inducer concentrations. Additionally, co-expression with chaperones can improve folding efficiency .

What purification strategies yield the highest functional recovery of recombinant Nymphaea alba psbB?

Optimal purification of recombinant Nymphaea alba psbB requires a multi-step approach that preserves protein structure and function:

  • Initial extraction: Gentle solubilization using mild detergents (n-dodecyl β-D-maltoside or digitonin) is preferred over harsher alternatives like Triton X-100 to maintain structural integrity.

  • Affinity chromatography: For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin in the presence of stabilizing agents (glycerol 10-20%) and low concentrations of detergent.

  • Size exclusion chromatography: Secondary purification step to remove aggregates and improve purity, using appropriate buffer systems containing stabilizing agents.

Purification StepRecommended ConditionsCritical Considerations
Membrane isolationDifferential centrifugation (10,000g → 100,000g)Prevent proteolysis with protease inhibitors
Solubilization1% DDM or 2% digitonin, 4°C, overnightMaintain pH 7.5-8.0, include glycerol (10%)
IMACLinear imidazole gradient (10-300mM)Wash extensively to remove non-specific binding
Size exclusionSuperdex 200, flow rate 0.5 ml/minMonitor absorption at both 280nm and 650nm

The purified protein should be maintained in stabilizing buffer containing 0.05% detergent and 10% glycerol to prevent aggregation, with storage at -80°C after flash-freezing in liquid nitrogen to preserve activity.

What experimental approaches best characterize the chlorophyll binding properties of recombinant psbB?

Characterization of chlorophyll binding properties requires multiple complementary techniques:

  • Absorption spectroscopy: Measurement of absorption spectra between 350-750 nm reveals the characteristic peaks of bound chlorophyll molecules, particularly the Qy bands around 670-680 nm. The relative heights and positions of these peaks provide information about the number and environment of bound chlorophylls.

  • Circular dichroism (CD) spectroscopy: CD spectra in the visible region (400-750 nm) provide information about the spatial arrangement of chlorophylls and their interactions with the protein environment.

  • Fluorescence spectroscopy: Emission spectra upon excitation at various wavelengths help map energy transfer pathways among different chlorophyll molecules within the protein.

  • Reconstitution experiments: In vitro reconstitution of apo-protein with purified chlorophyll molecules can determine binding affinities and stoichiometry.

  • Quantum mechanics/molecular mechanics (QM/MM) analysis: Computational approaches can predict excitation energies of bound chlorophylls based on the protein environment .

The comparison of spectra between native and recombinant proteins provides crucial information about the successful reconstitution of chlorophyll-binding sites. Researchers should conduct parallel analyses of recombinant protein with and without chlorophyll reconstitution to quantify binding efficiency.

How can researchers effectively design quasi-experimental studies to evaluate psbB function in photosynthetic efficiency?

When investigating the role of psbB in photosynthetic efficiency, researchers can implement specialized quasi-experimental designs:

  • Wait-list cross-over design: This approach allows for controlled introduction of modified psbB variants in plant systems while establishing baseline measurements. This design is particularly valuable when randomization at the individual plant level is not feasible .

  • Stepped-wedge design: Especially useful for field studies where gradual implementation is necessary, this approach introduces modified psbB variants to different plant clusters at pre-specified intervals, allowing each group to serve as its own control .

Key experimental design considerations include:

  • Multiple data collection points: Establishing robust baseline measurements before intervention and multiple follow-up measurements to track changes in photosynthetic parameters over time.

  • One-way cross-over: Plants initially serving as controls can later receive the intervention (modified psbB), but not vice versa, allowing for within-subject comparisons .

  • Stratification: Instead of true randomization, researchers can stratify plant specimens based on relevant parameters (age, size, initial photosynthetic capacity) to improve comparative validity.

When implementing these designs, researchers should employ multiple photosynthetic efficiency measurements including oxygen evolution rates, chlorophyll fluorescence parameters (Fv/Fm, NPQ), and carbon fixation rates to comprehensively evaluate the functional impact of psbB modifications.

How do the excitation energies of chlorophyll molecules in Nymphaea alba CP47 compare to those in other species?

The excitation energy profile of chlorophyll molecules in CP47 is critical for understanding energy transfer pathways within Photosystem II. While specific data for Nymphaea alba is limited, comparative analysis with other photosynthetic organisms provides valuable insights:

  • Site energy distribution: CP47 typically contains 16 chlorophyll molecules with varying excitation energies. In cyanobacterial systems, the site energies range from approximately 14,500 cm^-1 to 15,000 cm^-1, with the most red-shifted chlorophylls identified as B3 followed by B1 .

  • Red-shifted chlorophylls: These specialized chlorophyll molecules have lower excitation energies and are crucial for funneling energy toward the reaction center. The exact identity and energetics of these chlorophylls in Nymphaea alba would likely show some species-specific variations compared to cyanobacterial or terrestrial plant systems.

  • Protein environment effects: Quantum mechanics/molecular mechanics (QM/MM) approaches have demonstrated that the protein environment can shift chlorophyll excitation energies by approximately 200-600 cm^-1 through various electrostatic interactions .

The following table summarizes predicted site energy differences between typical cyanobacterial and expected Nymphaea alba CP47 chlorophylls:

Chlorophyll PositionTypical Cyanobacterial Excitation Energy (cm^-1)Predicted Nymphaea alba Excitation Energy (cm^-1)Environmental Factors
B114,65014,600-14,700Second most red-shifted, affected by nearby aromatic residues
B314,50014,450-14,550Most red-shifted, strong hydrogen bonding interactions
B514,85014,800-14,900Moderate energy, influenced by water molecules
B614,95014,900-15,000Higher energy, less pronounced environmental effects

Researchers should implement time-dependent density functional theory calculations with appropriate range-separated functionals to accurately predict the excitation profile of Nymphaea alba CP47 chlorophylls .

What methodologies can resolve contradictions in experimental data regarding psbB site-directed mutagenesis outcomes?

When researchers encounter contradictory results from site-directed mutagenesis studies of psbB, several methodological approaches can help resolve these discrepancies:

  • Standardized phenotypic characterization protocol:

    • Implement consistent growth conditions across experiments (light intensity, duration, temperature)

    • Establish quantitative thresholds for phenotypic classifications

    • Use multiple complementary measurements for each phenotype (e.g., both chlorophyll fluorescence and oxygen evolution)

  • Comprehensive mutagenesis analysis:

    • Create a matrix of mutation types (conservative vs. non-conservative)

    • Perform multiple amino acid substitutions at each position of interest

    • Analyze the patterns of functional effects across different mutation types

  • Structural context integration:

    • Map mutations onto available structural models or homology models

    • Identify potential long-range interactions affected by mutations

    • Use molecular dynamics simulations to predict structural perturbations

  • Combined in vivo and in vitro approach:

    • Express and analyze mutant proteins both in native systems and in reconstituted systems

    • Compare functional parameters between systems to identify context-dependent effects

    • Isolate specific biochemical steps affected by each mutation

  • Meta-analysis framework:

    • Develop a systematic scoring system for experimental variables

    • Weight results based on methodological rigor

    • Identify pattern-based explanations for apparent contradictions

By implementing these approaches, researchers can distinguish genuine biological variability from methodological artifacts and develop more robust models of structure-function relationships in the psbB protein.

How can structural stability variations between native and recombinant Nymphaea alba psbB be experimentally quantified?

Quantifying structural stability differences between native and recombinant psbB requires a multi-parameter approach:

  • Differential scanning calorimetry (DSC):

    • Measure thermal unfolding transitions and calculate thermodynamic parameters

    • Compare denaturation temperatures (Tm) and enthalpy changes (ΔH)

    • Analyze the cooperativity of unfolding transitions

  • Limited proteolysis coupled with mass spectrometry:

    • Expose proteins to controlled proteolytic digestion

    • Identify regions with differential susceptibility to proteolysis

    • Map proteolytic sensitivity to structural elements

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Measure the rate of hydrogen-deuterium exchange across the protein

    • Identify regions with differential solvent accessibility or hydrogen bonding

    • Generate heat maps of structural differences

  • Molecular dynamics simulations:

    • Perform extended simulations (>100 ns) of both native and recombinant structures

    • Calculate root mean square fluctuations (RMSF) for each residue

    • Identify regions with differential flexibility or stability

  • Fluorescence-based thermal shift assays:

    • Use environment-sensitive fluorescent dyes (SYPRO Orange) to monitor thermal unfolding

    • Generate melting curves under various conditions (pH, salt, detergents)

    • Calculate stability parameters and identify differential stabilizing conditions

Stability ParameterMeasurement TechniqueExpected DifferencesInterpretation
Thermal stability (Tm)DSC, thermal shift assay3-8°C lower for recombinantIndicates incomplete folding or missing stabilizing interactions
Proteolytic resistanceLimited proteolysisHigher susceptibility in loop regionsSuggests increased flexibility in connecting elements
Solvent accessibilityHDX-MSFaster exchange in transmembrane regionsIndicates imperfect membrane incorporation
Conformational flexibilityMD simulationsHigher RMSF in recombinantPoints to specific destabilized regions

By correlating stability differences with functional parameters, researchers can identify critical structural elements that require optimization in recombinant expression systems .

What are effective approaches to troubleshoot low expression yields of recombinant Nymphaea alba psbB in E. coli?

When facing low expression yields of recombinant Nymphaea alba psbB, researchers should implement a systematic troubleshooting approach:

  • Codon optimization strategy revision:

    • Analyze codon adaptation index for the current construct

    • Identify rare codon clusters that may cause ribosomal stalling

    • Redesign with codon optimization specifically for membrane proteins in E. coli

  • Expression vector optimization:

    • Test different promoter systems (T7, trc, arabinose-inducible)

    • Evaluate various fusion tags (His, GST, MBP) for their effect on expression and solubility

    • Implement low-copy number vectors to reduce cellular stress

  • Host strain selection:

    • Test specialized strains for membrane proteins (C41(DE3), C43(DE3))

    • Evaluate strains with additional rare tRNA genes (Rosetta, CodonPlus)

    • Consider strains with reduced protease activity (BL21(DE3) pLysS)

  • Expression condition matrix:

ParameterRecommended RangeOptimization Strategy
Induction temperature16-30°CDecrease in 3°C increments
IPTG concentration0.05-0.5 mMTest lower concentrations for slower expression
Cell density at inductionOD600 0.4-0.8Earlier induction may reduce inclusion body formation
Post-induction time4-20 hoursExtended time at lower temperatures
Media compositionLB, TB, M9 with supplementsAdd glycylbetaine and sorbitol as chemical chaperones
  • Co-expression strategies:

    • Co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Include specific membrane protein folding facilitators (YidC)

    • Consider dual plasmid systems with tightly controlled expression ratios

By implementing these approaches systematically, researchers can identify the limiting factors in recombinant psbB expression and develop optimized protocols for improved yields .

How can researchers accurately assess the functional integrity of recombinant psbB compared to native protein?

Assessing functional integrity requires a comparative analysis across multiple parameters:

  • Spectroscopic comparison:

    • Overlay absorption spectra of native and recombinant proteins

    • Quantify differences in peak positions and ratios

    • Perform difference spectroscopy to highlight subtle variations

  • Binding assays for interaction partners:

    • Measure binding affinities for other PSII subunits

    • Compare association/dissociation kinetics

    • Assess oligomeric state stability through size exclusion chromatography

  • Functional reconstitution:

    • Attempt to incorporate recombinant psbB into psbB-depleted PSII complexes

    • Measure restoration of photosynthetic electron transport

    • Compare quantum efficiency of reconstituted systems

  • Chlorophyll binding capacity:

    • Determine chlorophyll/protein ratio

    • Assess binding site occupancy through specialized spectroscopic techniques

    • Compare energy transfer efficiency between bound chlorophylls

  • Structural integrity assessment:

    • Compare secondary structure content via circular dichroism

    • Evaluate thermal stability profiles

    • Analyze proteolytic digestion patterns

By establishing quantitative thresholds for functional equivalence across these parameters, researchers can objectively determine the degree to which recombinant protein recapitulates native function and identify specific aspects requiring further optimization.

What experimental designs best address the challenge of comparing photosynthetic efficiency across different Nymphaea alba variants expressing modified psbB proteins?

When comparing photosynthetic efficiency across Nymphaea alba variants with modified psbB proteins, researchers should implement robust experimental designs that account for both genetic and environmental variables:

  • Randomized complete block design:

    • Group plants into blocks based on initial physiological parameters

    • Randomly assign treatments within each block

    • Control for microenvironmental variations

  • Split-plot experimental design:

    • Assign major environmental variables (light intensity, temperature) to main plots

    • Allocate genetic variants to subplots

    • Efficiently test interaction effects between environmental conditions and genetic modifications

  • Repeated measures design with systematic controls:

    • Track individual plants over time to account for developmental differences

    • Include technical control measurements at each time point

    • Use wild-type reference plants within each experimental group

The following multi-parameter assessment matrix ensures comprehensive evaluation:

This comprehensive approach, combined with appropriate statistical methods such as mixed-effects modeling, allows researchers to isolate the specific effects of psbB modifications while accounting for natural variation and environmental influences .

What are the most promising approaches for studying the interaction between Nymphaea alba psbB and other PSII components?

Future research into psbB interactions should employ cutting-edge methodologies:

  • Cross-linking mass spectrometry (XL-MS):

    • Utilize MS-cleavable cross-linkers to capture transient interactions

    • Map interaction interfaces at amino acid resolution

    • Identify differences in interaction networks between species

  • Cryo-electron microscopy of native membranes:

    • Direct visualization of PSII supercomplexes in native environments

    • Subtomogram averaging to resolve structural heterogeneity

    • Comparative analysis with terrestrial plant systems

  • Single-molecule FRET studies:

    • Engineer specific fluorophore attachment sites

    • Monitor dynamic interactions in real-time

    • Quantify interaction kinetics under various conditions

  • Hydrogen-deuterium exchange coupled with mass spectrometry:

    • Map conformational changes upon complex formation

    • Identify regions with altered solvent accessibility

    • Detect allosteric networks within the protein complex

  • In situ proximity labeling:

    • Genetically incorporate proximity biotin ligases

    • Identify interaction partners under physiological conditions

    • Compare interaction networks across different environmental conditions

These approaches will help elucidate the unique aspects of Nymphaea alba PSII architecture and the specific role of psbB in maintaining photosynthetic efficiency in aquatic environments .

How can comparative genomics inform the evolutionary adaptations of psbB in Nymphaea alba for aquatic photosynthesis?

Comparative genomics provides powerful insights into the evolutionary adaptations of psbB:

  • Phylogenetic analysis across aquatic plant lineages:

    • Construct maximum likelihood trees of psbB sequences

    • Identify convergent evolutionary patterns in independent aquatic lineages

    • Map adaptive mutations to functional domains

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive selection

    • Compare selection patterns between aquatic and terrestrial lineages

    • Correlate selection hotspots with structural features

  • Ancestral sequence reconstruction:

    • Infer ancestral psbB sequences at key evolutionary transitions

    • Experimentally characterize reconstructed ancestral proteins

    • Identify critical mutations that facilitated aquatic adaptation

  • Structural biology integration:

    • Map sequence variations onto structural models

    • Identify co-evolving residue networks

    • Predict functional consequences of adaptive mutations

  • Environmental correlation analysis:

    • Associate sequence variations with specific habitat parameters

    • Identify mutations correlated with water depth, clarity, or temperature

    • Develop predictive models for structure-environment relationships

This integrative approach will reveal how Nymphaea alba psbB has been specifically adapted for efficient light harvesting in aquatic environments where light quality and quantity differ significantly from terrestrial conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.