Recombinant Nymphaea alba Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Photosystem II Assembly Studies

  • Role in PSII Biogenesis: PsbD is essential for assembling the PSII reaction center. Studies in Thermosynechococcus elongatus show psbD mRNA levels shift under high light or UV stress, influencing D2 isoform replacement .

  • Mutagenesis: Recombinant PsbD enables site-directed mutagenesis to probe residues critical for electron transport .

Stress Response Analysis

  • Environmental Acclimation: In cyanobacteria, PsbD isoforms (e.g., PsbD1 vs. PsbD2) exhibit distinct electron transport kinetics under temperature or UV stress .

Diagnostic and Quantitative Tools

  • Western Blot Standard: Used with global anti-PsbD antibodies (e.g., Agrisera AS06 146) to quantify D2 protein in plant/algal extracts .

  • Protocols: Optimized for NuPAGE gels, with detection limits of ~0.25 pmoles/µL .

Comparative Genomic Insights

Chloroplast genome analyses of N. alba reveal:

  • IR/SSC Boundaries: The psbD gene resides near the small single-copy (SSC) region, flanked by trnT and psbC .

  • Evolutionary Conservation: psbD exhibits minimal sequence variation across angiosperms, underscoring its functional essentiality .

Limitations and Future Directions

  • Partial Sequence: Current recombinant variants lack the full-length protein (353 vs. ~400 residues in mature D2) .

  • Species-Specificity: Functional insights from cyanobacterial PsbD (e.g., Synechocystis) require validation in N. alba.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its incorporation.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Nymphaea alba (White water-lily) (Castalia alba)
Target Names
psbD
Target Protein Sequence
MTIALGRFTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) functions as a light-driven water:plastoquinone oxidoreductase. It harnesses light energy to extract electrons from H₂O, generating O₂ and a proton gradient for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain that converts light excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor, and subsequent electron acceptors. D2 is essential for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural role of D2 protein in Photosystem II?

The D2 protein (PSII D2 protein) is one of the core components of Photosystem II, functioning alongside D1 protein to facilitate photosynthetic reactions in the membrane-bound protein complex. Research has demonstrated that D2 plays a crucial structural role in stabilizing the PSII complex within the membrane . The protein contains 353 amino acid residues in Nymphaea alba and has a molecular weight of approximately 32,000-34,000 Da . It contributes to the formation of the photosynthetic reaction center that catalyzes the light-driven oxidation of water.

What is the amino acid sequence of Nymphaea alba D2 protein?

The complete amino acid sequence of the Nymphaea alba D2 protein consists of 353 amino acids as follows:

MTIALGRFTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGAFGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPQGSGWFFAPSFGVAAIFFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSKNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Understanding this sequence is essential for structure-function studies and comparative analyses with D2 proteins from other species.

How should recombinant D2 protein be stored for optimal stability?

For research applications, recombinant Nymphaea alba D2 protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein . For extended storage periods, conservation at -80°C is recommended. To maintain protein integrity, repeated freezing and thawing cycles should be avoided. Working aliquots may be stored at 4°C for up to one week to minimize degradation caused by temperature fluctuations .

What techniques are used to study D2 protein function in Photosystem II?

Several sophisticated techniques have been employed to investigate D2 protein function:

  • Flash-induced absorption spectroscopy: This technique measures absorption changes in the Soret region arising from the [PD1PD2]+ state, providing insights into electron transfer dynamics within PSII .

  • Site-directed mutagenesis: Creating specific mutations in the psbD gene allows researchers to study the functional consequences of amino acid substitutions. For example, replacing D2-His197 with alanine has been used to investigate the P D2 environment's role in spectral characteristics .

  • Manganese-depletion protocols: Treatment with NH2OH (approximately 20 mM) and EDTA (1 mM) followed by washing with buffer solutions enables the study of D2 in Mn-depleted PSII cores .

  • Recombinant protein expression and purification: This allows for the production of wild-type or mutant D2 proteins for structural and functional characterization .

How can researchers effectively isolate and purify PSII complexes containing D2 protein?

PSII purification protocols typically involve:

  • Cell harvesting and membrane isolation from photosynthetic tissue

  • Solubilization of thylakoid membranes using detergents

  • Multiple chromatography steps (often ion exchange followed by size exclusion)

  • Concentration using centrifugal filter units (typically with 100 kDa cutoff)

For specific work with Thermosynechococcus elongatus, researchers have employed protocols involving NH2OH treatment (20 mM) and EDTA (1 mM) for Mn-depletion, followed by washing cycles in buffer containing 1 M betaine, 15 mM CaCl2, 15 mM MgCl2, and 40 mM MES at pH 6.5 . Final samples are typically concentrated and resuspended in appropriate buffers for spectroscopic or biochemical analyses.

What methods detect protein-protein interactions involving D2 in the PSII complex?

Protein-protein interactions involving D2 can be detected through several methodologies:

  • Cross-linking studies: Chemical cross-linkers can be used to identify proteins that are in close proximity to D2 within the PSII complex.

  • Co-immunoprecipitation: Antibodies against D2 can pull down interacting partners.

  • Spectroscopic techniques: Flash-induced absorption changes can detect interactions between D2 and other components of PSII, such as the interaction between PD2 (chlorophyll in D2) and PD1 (chlorophyll in D1) .

  • Mutational analysis: Studies have shown that mutations in D2 affect the stability of D1, indicating functional interactions between these proteins. For instance, research on Chlamydomonas reinhardtii demonstrated that a frame-shift mutation in psbD resulted in the absence of both D2 and D1 proteins, even though the gene for D1 was intact .

How do mutations in the psbD gene affect PSII function and assembly?

Mutations in the psbD gene can have profound effects on PSII function and assembly:

  • Protein stability: A 46 bp direct DNA duplication in the coding region of psbD in Chlamydomonas reinhardtii caused a frame-shift resulting in a truncated D2 peptide of 186 amino acids instead of the normal 352 . This truncated protein was found to be highly unstable.

  • Impact on partner proteins: In the absence of stable D2, the D1 protein is also not detected despite normal levels of D1 mRNA, suggesting D2 plays a role in regulating D1 at either the translational or post-translational level .

  • Core complex assembly: While other core PSII proteins are synthesized and inserted into the membrane in D2 mutants, they fail to accumulate, indicating D2's essential role in PSII complex assembly and stability .

  • Spectroscopic changes: Mutations such as D2-His197Ala alter the spectroscopic properties of the PD2 environment, affecting the formation of characteristic "W-shaped" signals in absorption difference spectra .

What is the evolutionary significance of D2 protein conservation across species?

The D2 protein, encoded by psbD, shows significant conservation across photosynthetic organisms, reflecting its fundamental role in photosynthesis. Phylogenetic analyses of chloroplast genomes have identified psbD as one of the genes supporting the monophyly of core Eudicots, indicating its evolutionary significance .

Comparative genomic studies have revealed:

  • The psbD gene has been used as a marker in phylogenetic analyses to resolve relationships among plant lineages.

  • In core Eudicots, psbD has been identified as one of the genes providing phylogenetic signal at codon positions 1+2+3 .

  • The conservation of functional domains within D2 across diverse species suggests strong selective pressure to maintain its structure due to its critical role in photosynthesis.

  • Analysis of insertion-deletion mutations (indels) in genes like psbD has provided insights into plant evolutionary relationships, particularly in basal angiosperms .

How do spectroscopic properties of the D2 protein change under different experimental conditions?

The spectroscopic properties of D2 protein, particularly in the context of the [PD1PD2]+ chlorophyll cation radical, exhibit distinct changes under various experimental conditions:

  • pH effects: Studies conducted at pH 8.6 have revealed specific absorption changes in the Soret region arising from the [PD1PD2]+ state .

  • Oxidation state of nearby residues: When Tyrosine D (TyrD) is oxidized, an additional "W-shaped" signal with troughs at 434 nm and 446 nm appears in the [PD1PD2]+-minus-[PD1PD2] difference spectrum .

  • Mutational effects:

    • In the D2-Tyr160Phe mutant (TyrD-less), the "W-shaped" spectral feature is detected regardless of flash number.

    • Similarly, in the D2-His189Leu mutant, where TyrD is present but not oxidizable, the "W-shaped" signal is observed after all flashes .

    • The D2-His197Ala mutant, which affects coordination to PD2, also shows the "W-shaped" signal after all flashes.

These observations suggest that changes in the hydrogen bond network or protein conformation around PD2, either from mutations or TyrD oxidation, affect pigment bands or couplings between pigments .

What are common challenges in expressing and purifying recombinant D2 protein?

Researchers commonly encounter several challenges when working with recombinant D2 protein:

  • Protein instability: As observed in mutant studies, the D2 protein can be highly unstable when its structure is compromised . Researchers should consider using optimized buffer conditions with stabilizing agents.

  • Membrane protein solubilization: As an integral membrane protein, D2 requires careful solubilization protocols using appropriate detergents.

  • Maintaining native conformation: Preserving the native structure is crucial for functional studies, potentially requiring reconstitution into liposomes or nanodiscs.

  • Protein aggregation: D2's hydrophobic nature can lead to aggregation during purification, which may be mitigated by optimizing buffer conditions, detergent selection, and temperature.

  • Co-purification requirements: Since D2 functions in complex with other PSII components, particularly D1, co-expression systems may be necessary for obtaining functionally relevant preparations.

How can researchers distinguish between effects on D1 versus D2 proteins in experimental studies?

Distinguishing between effects on D1 versus D2 proteins requires thoughtful experimental design:

  • Specific antibodies: Using antibodies that selectively recognize D1 or D2 proteins can help differentiate between the two in immunoblotting experiments.

  • Genetic approaches: Creating specific mutations in either psbA (D1) or psbD (D2) genes allows researchers to attribute phenotypic effects to a particular protein. For example, studies have shown that mutations in psbD affecting D2 stability also impact D1 accumulation, even though the psbA gene is intact .

  • Spectroscopic signatures: Certain spectroscopic features are specifically associated with either D1 or D2. For instance, research has identified spectral features associated with the PD2 environment that can be distinguished from those related to PD1 .

  • Pulse-chase experiments: Pulse labeling with radioactive amino acids can track the synthesis and degradation rates of D1 and D2 separately, as demonstrated in studies showing that truncated D2 is never detected even after pulse-labeling .

What are emerging techniques for studying D2 protein dynamics in vivo?

Several cutting-edge approaches are being developed to study D2 protein dynamics in living systems:

  • Fluorescence labeling techniques: Site-specific fluorescent labeling of D2 protein can allow real-time monitoring of its assembly into PSII and turnover under various stress conditions.

  • Cryo-electron microscopy: Advanced cryo-EM approaches enable visualization of structural dynamics of PSII complexes at near-atomic resolution, providing insights into how D2 interacts with other components.

  • Time-resolved spectroscopy: Ultra-fast spectroscopic techniques can capture the dynamic changes in D2 during photosynthetic electron transport.

  • Multi-omics integration: Combining genomics, proteomics, and metabolomics data to understand how D2 functions within the broader context of photosynthetic regulation.

  • Synthetic biology approaches: Engineering minimal PSII systems with defined components to understand the essential functions of D2.

How might comparative studies of D2 proteins from different species inform biotechnological applications?

Comparative studies of D2 proteins across species offer valuable insights for biotechnological applications:

  • Stress tolerance: Some species have D2 proteins with enhanced stability under environmental stresses. Identifying the structural features responsible could inform the engineering of more resilient photosynthetic systems.

  • Photosynthetic efficiency: Variations in D2 protein may contribute to differences in photosynthetic efficiency across species. Understanding these differences could guide efforts to enhance crop productivity.

  • Evolutionary adaptations: Analysis of D2 sequences across evolutionary lineages, such as the distinctive features in Nymphaea alba compared to other species, may reveal adaptive strategies for specific ecological niches .

  • Phylogenetic applications: The psbD gene has proven valuable for resolving evolutionary relationships among plants . Further refinement of this approach could improve our understanding of plant evolution and diversity.

Spectroscopic Properties of D2 Protein Under Various Conditions

Experimental ConditionSpectral FeaturesKey ObservationsReference
Wild-type PSII, first flash (TyrD reduced)Standard [PD1PD2]+-minus-[PD1PD2] difference spectrumNo "W-shaped" signal
Wild-type PSII, subsequent flashes (TyrD oxidized)"W-shaped" signal with troughs at 434 nm and 446 nmAdditional feature compared to first flash
D2-Tyr160Phe mutant (TyrD-less)"W-shaped" signal presentFeature detected regardless of flash number
D2-His189Leu mutant"W-shaped" signal presentTyrD present but not oxidizable
D2-His197Ala mutant"W-shaped" signal presentAlteration in PD2 coordination

Comparison of psbD Contributions to Phylogenetic Signal Across Plant Lineages

TaxonCodon Positions 1+2+3Codon Positions 1+2Amino AcidsReference
Core EudicotspsbD identified as phylogenetic markerNot specifically identifiedNot specifically identified
NymphaealesNot specifically identifiedNot specifically identifiedNot specifically identified
AmborellaNot identified for psbDNot identified for psbDNot identified for psbD
PoaceaeNot identified for psbDNot identified for psbDNot identified for psbD

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.