Recombinant Nymphaea alba Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Introduction to Nymphaea alba and Photosystem Q(B) Protein

Among the protein-coding genes in the Nymphaea alba chloroplast genome is the psbA gene, which encodes the Photosystem Q(B) protein, also known as Photosystem II protein D1. This protein plays a fundamental role in oxygenic photosynthesis across various photosynthetic organisms, from cyanobacteria to flowering plants. The psbA-encoded protein forms a crucial part of the reaction center of Photosystem II, where it facilitates electron transfer during the light-dependent reactions of photosynthesis.

Applications in Research and Biotechnology

Recombinant psbA proteins have numerous applications in research and biotechnology, which would likely extend to a recombinant form of the Nymphaea alba variant. These applications include:

Herbicide Research

As the D1 protein serves as a binding site for various herbicides, the recombinant Nymphaea alba psbA protein could facilitate the development and testing of herbicides with potential applications in aquatic weed management . Additionally, it could be used to study herbicide resistance mechanisms in aquatic plants.

Evolutionary Studies

Comparative analysis of the Nymphaea alba psbA protein with those from other species can provide insights into the evolutionary relationships and adaptations of photosynthetic machinery across different plant lineages. This is particularly relevant given the position of water lilies as early-diverging angiosperms.

Antibody Production

The recombinant protein could serve as an antigen for producing antibodies specific to the D1 protein, which would be valuable tools for localization and quantification studies in Nymphaea alba and potentially other aquatic plants.

Environmental Biomonitoring

Given the essential role of the psbA protein in photosynthesis, changes in its expression or function could serve as indicators of environmental stress in aquatic ecosystems. The recombinant protein could facilitate the development of assays for monitoring the health of aquatic plants in response to various environmental factors.

Comparative Analysis with Other Species

The psbA gene and its encoded protein have been extensively studied across diverse photosynthetic organisms, revealing both conserved features essential for photosynthetic function and species-specific variations that may reflect adaptations to different ecological niches.

In cyanobacteria such as Anacystis nidulans, the genome contains three psbA genes (psbAI, psbAII, and psbAIII), which are expressed at different levels . Two of these genes (psbAII and psbAIII) encode identical proteins that differ from the psbAI product by 25 out of 360 amino acid residues . Interestingly, each of these genes can independently produce sufficient functional QB protein to support normal photoautotrophic growth, indicating functional redundancy .

Table 2: Comparative Analysis of psbA Across Different Photosynthetic Organisms

SpeciesOrganism TypepsbA Gene FeaturesProtein LengthNotable Characteristics
Nymphaea albaAquatic flowering plantPart of chloroplast genome~344 (inferred)Adaptations to aquatic environment
Anacystis nidulansCyanobacteriumThree copies (psbAI, II, III)360Differential expression levels
Conocephalum conicumLiverwortSingle copy (inferred)344His-tagged in recombinant form
Calycanthus floridusTerrestrial flowering plantSingle copy (inferred)344His-tagged in recombinant form
Multiple speciesVarious plants and algaeVariable340-360Available as commercial recombinant proteins

This comparative analysis highlights the evolutionary conservation of the psbA protein structure and function across diverse photosynthetic lineages, while also suggesting potential for species-specific adaptations that may be particularly relevant for an aquatic plant like Nymphaea alba.

Future Research Directions

Several promising research directions could enhance our understanding of the recombinant Nymphaea alba psbA protein:

Functional Studies

Investigation of the functional properties of the recombinant protein, particularly in relation to electron transport efficiency under varying light conditions typical of aquatic environments, could reveal specialized adaptations.

Comparative Ecophysiology

Comparative analysis with psbA proteins from other aquatic plants could identify common adaptations to aquatic environments, contributing to our understanding of the evolution of photosynthesis in different ecological contexts.

Optimized Expression Systems

Development of optimized expression systems for the efficient production of functional recombinant Nymphaea alba psbA protein would facilitate various research applications and potentially overcome challenges associated with membrane protein expression.

Environmental Response Studies

Investigation of how environmental factors affect the expression and function of the psbA gene in Nymphaea alba could provide insights into the plant's adaptive responses and potential vulnerability to environmental changes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Nymphaea alba (White water-lily) (Castalia alba)
Target Names
psbA
Target Protein Sequence
MTAILERRESTSLWGRFCNWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIVPTSAAIGLHFYPIWEASSVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function

Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient used for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, and several subsequent electron acceptors.

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Nymphaea alba and what makes its photosystem proteins significant for research?

Nymphaea alba, commonly known as the European white water lily, is a perennial aquatic plant native to temperate regions of Europe, parts of North Africa, and Asia. It thrives in still or slow-moving freshwater bodies like ponds and lakes and is characterized by large, round leaves that float on the water's surface and fragrant white flowers . The photosystem proteins of Nymphaea alba are of particular interest to researchers due to their role in photosynthetic efficiency in aquatic environments. Unlike terrestrial plants, water lilies have adapted to function optimally in water-saturated conditions with variable light exposure, making their photosystem components valuable study subjects for understanding adaptive photosynthetic mechanisms.

What is the function of the psbA gene in photosystems?

The psbA gene encodes the D1 protein, which forms a critical component of the Photosystem II (PSII) reaction center. This protein plays an essential role in the electron transport chain during photosynthesis. Specifically, the D1 protein binds cofactors necessary for the water-splitting reaction and electron transport in PSII. Research has shown that in photosynthetic organisms, psbA genes are differentially regulated in response to environmental conditions such as light intensity, UV radiation, and temperature . This regulation allows organisms to adapt their photosynthetic machinery to changing environmental conditions, optimizing energy capture while minimizing photo-damage.

How does psbA expression respond to environmental conditions?

Based on studies of photosynthetic organisms, psbA gene expression shows remarkable responsiveness to environmental factors. For example, in Thermosynechococcus elongatus, exposure to high-intensity visible light (500 μmol m⁻² s⁻¹) causes a shift in the dominant psbA transcript from psbA1 to psbA3 . Similarly, UV-B radiation increases the abundance of psbA3 at the expense of psbA1. Temperature also affects expression patterns, with psbA1 becoming the single dominating mRNA species at elevated temperatures (60°C) . While these specific findings come from T. elongatus, similar regulatory mechanisms likely exist in other photosynthetic organisms including Nymphaea alba, allowing for dynamic adjustment of photosynthetic capacity under varying environmental conditions.

What is the relationship between psbA and other photosystem proteins?

The psbA-encoded D1 protein works in close coordination with other photosystem components, particularly the D2 protein encoded by psbD. Together, these proteins form the heterodimeric core of the PSII reaction center. Additional proteins, including psbT, contribute to the structural integrity and function of the PSII complex . The intricate relationships between these proteins are critical for maintaining electron transport efficiency. Research has shown that changes in the expression of one photosystem component often coincide with changes in others, as seen in the coordinated regulation of psbA and psbD genes under high light conditions . This coordinated regulation ensures optimal PSII function across varying environmental conditions.

What are the optimal conditions for expressing recombinant Nymphaea alba psbA protein?

When designing expression systems for recombinant Nymphaea alba psbA protein, researchers should consider using eukaryotic systems that can handle complex membrane proteins. Based on successful approaches with similar photosystem proteins, baculovirus expression systems have proven effective . The expression vector should contain appropriate promoters for controlled expression, and the growth conditions should mimic those favorable for Nymphaea alba, including temperatures around 20°C and high humidity conditions (approximately 70%) . For optimal results, the expression should be monitored using quantitative RT-PCR to track transcript levels, combined with biophysical measurements to assess protein functionality .

How should researchers design experiments to study psbA regulation under variable light conditions?

To effectively study psbA regulation under variable light conditions, researchers should design experiments that:

  • Establish baseline expression under standard conditions (approximately 40 μmol m⁻² s⁻¹ light intensity)

  • Expose samples to various light intensities (from low to high, e.g., 500 μmol m⁻² s⁻¹)

  • Include UV-B radiation exposure tests

  • Monitor temperature consistently (preferably at the optimal 20°C for Nymphaea alba)

  • Use quantitative RT-PCR to measure transcript levels of all psbA isoforms

  • Employ biophysical techniques such as chlorophyll fluorescence and thermoluminescence to assess functional changes in PSII

This experimental design allows for the comprehensive evaluation of psbA regulation patterns as demonstrated in previous studies with other photosynthetic organisms . Time-course measurements are crucial to capture the dynamics of regulatory changes, and inclusion of protein synthesis inhibitors like lincomycin can help distinguish between de novo synthesis and protein turnover mechanisms.

What methodologies are most effective for isolating and purifying recombinant psbA protein from Nymphaea alba?

For effective isolation and purification of recombinant psbA protein, researchers should employ a multi-step protocol:

  • Cell lysis under conditions that preserve membrane protein integrity

  • Differential centrifugation to isolate thylakoid membrane fractions

  • Solubilization using mild detergents (e.g., n-dodecyl-β-D-maltoside)

  • Affinity chromatography utilizing engineered tags

  • Size exclusion chromatography for final purification

When working with commercial recombinant proteins, such as those similar to the psbT protein mentioned in the search results, researchers should consider the protein purity (>85% as determined by SDS-PAGE is typically acceptable) and proper reconstitution protocols . Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage at -20°C/-80°C is recommended for maintaining protein stability and functionality .

What controls should be included when studying electron transport activity in systems with recombinant psbA?

When designing experiments to study electron transport activity in systems with recombinant psbA, researchers should include the following controls:

Control TypePurposeMeasurement Technique
Wild-type proteinBaseline comparisonChlorophyll fluorescence
No-protein controlBackground activityOxygen evolution
DCMU treatmentInhibit electron flowFluorescence decay kinetics
Temperature variationAssess thermal stabilityThermoluminescence
Light intensity gradientDetermine light dependencyElectron transport rate

Additionally, researchers should monitor charge recombination characteristics of the S₂QA⁻ and S₂QB⁻ states using chlorophyll fluorescence and thermoluminescence measurements . These techniques can reveal important functional differences between protein isoforms, as demonstrated by the faster decay of flash-induced chlorophyll fluorescence in the presence of DCMU and lower peak temperature of Q and B thermoluminescence bands observed when certain D1 isoforms replace others .

How should researchers interpret changes in chlorophyll fluorescence patterns when studying psbA functionality?

When interpreting chlorophyll fluorescence data in psbA functionality studies, researchers should focus on several key parameters:

Researchers should compare these parameters across different experimental conditions and with reference to wild-type controls. For example, when analyzing data from experiments with different psbA isoforms, it's important to note that changes in peak temperature of thermoluminescence bands (as observed in previous studies) suggest differences in the energetics of charge recombination .

What statistical approaches are most appropriate for analyzing differential psbA gene expression data?

For robust analysis of differential psbA gene expression data, researchers should consider the following statistical approaches:

  • Normalization methods: Use appropriate reference genes (e.g., 16S rRNA or rnpB) for normalizing qRT-PCR data. Multiple reference genes may be necessary for accurate normalization.

  • Statistical tests:

    • Paired t-tests for comparing two conditions

    • ANOVA with post-hoc tests for multiple condition comparisons

    • Non-parametric alternatives (Mann-Whitney U or Kruskal-Wallis) if data is not normally distributed

  • Correlation analysis: Pearson or Spearman correlation coefficients to assess relationships between gene expression and physiological parameters (e.g., electron transport rates).

  • Multivariate analysis: Principal component analysis (PCA) or hierarchical clustering to identify patterns across multiple genes and conditions.

When analyzing fold changes in expression, a minimum threshold of 1.5-2 fold is typically considered biologically significant, though this should be validated within the specific experimental context .

How can researchers reconcile contradictory findings in psbA protein function studies?

When faced with contradictory findings in psbA protein function studies, researchers should:

  • Examine methodological differences: Variations in experimental conditions, protein isolation techniques, or analytical methods can lead to apparently contradictory results.

  • Consider biological context: psbA function may vary based on:

    • Species-specific adaptations

    • Growth conditions prior to experimentation

    • Developmental stage of the organism

    • Presence of environmental stressors

  • Evaluate technical limitations: Different measurement techniques have inherent biases and limitations.

  • Perform comparative analyses: Directly compare results using standardized conditions across multiple experimental approaches.

  • Meta-analysis: Systematically analyze results from multiple studies to identify patterns and sources of variability.

For example, differences in the extent of D1 protein isoform replacement observed across studies might be reconciled by accounting for the duration of high light exposure, temperature conditions, or specific methodologies used to quantify protein content .

What molecular mechanisms drive the differential regulation of psbA isoforms under stress conditions?

The differential regulation of psbA isoforms under stress conditions involves complex molecular mechanisms including:

  • Transcriptional regulation: Stress-responsive elements in promoter regions may bind specific transcription factors. For instance, high light and UV-B radiation trigger signaling cascades that activate transcription factors binding to the psbA3 promoter, increasing its expression relative to psbA1 .

  • Post-transcriptional control: RNA-binding proteins and small RNAs may modulate mRNA stability and translation efficiency in a stress-dependent manner.

  • Redox sensing mechanisms: The plastoquinone pool redox state serves as a sensor for light intensity and can trigger signaling cascades affecting gene expression.

  • Retrograde signaling: Communication between chloroplasts and the nucleus coordinates the expression of photosynthetic genes in response to environmental cues.

Advanced research should focus on identifying the specific factors binding to regulatory elements of different psbA isoforms and elucidating the signal transduction pathways connecting environmental stimuli to gene expression changes. Techniques such as chromatin immunoprecipitation (ChIP), electrophoretic mobility shift assays (EMSA), and reporter gene assays can help identify these regulatory elements and their binding partners.

How does the D1 protein turnover rate vary among psbA isoforms, and what are the implications for photosystem resilience?

D1 protein turnover rates vary significantly among psbA isoforms, with important implications for photosystem resilience:

  • Differential susceptibility to photodamage: Studies suggest that different D1 isoforms exhibit varying susceptibility to photodamage. For example, when PsbA3 replaces PsbA1 as the main D1 protein isoform, altered charge recombination characteristics are observed, potentially affecting the protein's vulnerability to light-induced damage .

  • Repair efficiency: The rate at which damaged D1 proteins are replaced depends on:

    • Translation efficiency of the corresponding mRNA

    • Protease recognition and degradation of damaged proteins

    • Integration of newly synthesized proteins into PSII complexes

  • Energy cost: Frequent turnover of D1 protein represents a significant energy investment for the cell.

  • Adaptive significance: Different isoforms may be optimized for specific environmental conditions, allowing for ecological adaptation.

Studying this turnover rate requires pulse-chase experiments, potentially with isotope labeling, and quantitative protein analysis techniques. The finding that PsbA3 protein isoform replaces PsbA1 in about 65% of PSII centers after 2 hours of high light acclimation provides insight into the temporal dynamics of this process .

What potential applications exist for engineered recombinant psbA variants in enhancing photosynthetic efficiency?

Engineered recombinant psbA variants offer several potential applications for enhancing photosynthetic efficiency:

  • Stress tolerance: Introducing mutations that enhance stability under high light, temperature extremes, or other stressors could improve crop productivity in challenging environments.

  • Modified electron transport properties: Engineering the redox properties of the D1 protein could optimize electron flow and reduce the formation of reactive oxygen species.

  • Extended spectral sensitivity: Modifications that alter chlorophyll binding or interactions could potentially expand the wavelength range utilized for photosynthesis.

  • Biomaterial applications: As demonstrated with Nymphaea alba in memory devices, photosystem proteins have potential applications in bioelectronics and biomimetic energy systems .

Research approaches should include site-directed mutagenesis of key residues involved in cofactor binding or protein-protein interactions, followed by functional characterization using electron transport measurements, fluorescence analysis, and growth studies under various environmental conditions.

How do the structural properties of Nymphaea alba psbA compare to those of other photosynthetic organisms, and what functional insights can be derived from these differences?

Structural comparisons of psbA-encoded D1 proteins across photosynthetic organisms reveal evolutionary adaptations with significant functional implications:

  • Conserved regions: Core functional domains, including those involved in chlorophyll binding and electron transport, tend to be highly conserved across species.

  • Variable regions: Differences often occur in:

    • N-terminal and C-terminal domains

    • Loop regions connecting transmembrane helices

    • Specific amino acid residues at the QB binding site

  • Aquatic adaptations: As an aquatic plant, Nymphaea alba may possess structural adaptations in its D1 protein that optimize function in water-filtered light environments.

  • Isoform diversity: The number and divergence of psbA isoforms vary across species, reflecting different evolutionary strategies for environmental adaptation.

Advanced structural biology techniques, including X-ray crystallography and cryo-electron microscopy, combined with computational modeling and site-directed mutagenesis, can help elucidate the structure-function relationships. For example, examining differences in charge recombination characteristics between D1 isoforms can provide insights into structural variations affecting electron transport properties .

What factors might cause low expression levels of recombinant Nymphaea alba psbA protein, and how can these be addressed?

Low expression levels of recombinant Nymphaea alba psbA protein can result from multiple factors:

  • Codon optimization issues: Plant-specific codons may not be optimal in heterologous expression systems. Solution: Optimize codons for the expression host while maintaining critical amino acid sequences.

  • Protein toxicity: Membrane proteins can disrupt host membranes when overexpressed. Solution: Use inducible expression systems and optimize induction conditions.

  • Improper folding: Complex membrane proteins often require specific chaperones. Solution: Co-express with appropriate chaperones or consider expression hosts more closely related to the native organism.

  • mRNA stability issues: Transcript may be unstable in the expression host. Solution: Modify 5' and 3' untranslated regions to enhance stability.

  • Improper post-translational modifications: Solution: Select expression systems capable of performing required modifications.

For baculovirus expression systems, which have been used successfully for similar photosystem proteins , optimizing viral titer, infection duration, and harvest timing can significantly improve yields. Additionally, expression at lower temperatures (20-25°C) often enhances proper folding of complex proteins.

How can researchers address protein degradation issues when working with recombinant psbA?

To address protein degradation issues with recombinant psbA:

  • Use appropriate protease inhibitors: Include a comprehensive protease inhibitor cocktail during all purification steps.

  • Optimize buffer conditions:

    • Maintain pH between 6.5-7.5

    • Include stabilizing agents such as glycerol (5-50%) for long-term storage

    • Consider adding specific cofactors that stabilize the protein structure

  • Temperature control: Process samples at 4°C and store at -20°C/-80°C for extended periods .

  • Avoid freeze-thaw cycles: Aliquot purified protein and avoid repeated freezing and thawing .

  • Consider protein engineering: Introduce stabilizing mutations that do not affect function but enhance stability.

  • Optimize reconstitution protocols: For lyophilized proteins, carefully follow reconstitution guidelines, such as using deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL .

The shelf life of liquid formulations is typically around 6 months at -20°C/-80°C, while lyophilized forms can maintain stability for approximately 12 months under the same storage conditions .

What troubleshooting approaches can help resolve inconsistent results in psbA functional assays?

When encountering inconsistent results in psbA functional assays, researchers should systematically address potential sources of variability:

  • Sample preparation standardization:

    • Ensure consistent protein concentration across experiments

    • Standardize membrane fraction isolation procedures

    • Verify protein integrity by SDS-PAGE before functional assays

  • Assay condition control:

    • Maintain consistent temperature during measurements

    • Control light intensity precisely

    • Calibrate measuring equipment regularly

    • Prepare fresh reagents for each experiment

  • Address biological variability:

    • Use biological replicates from independent preparations

    • Control for developmental stage of source material

    • Consider circadian effects on photosystem function

  • Technical validation:

    • Include internal standards in each assay

    • Perform positive and negative controls

    • Validate results using complementary techniques

For example, when measuring electron transport rates, inconsistencies might arise from variations in chlorophyll concentration or the integrity of the electron transport chain. Cross-validation using multiple techniques (e.g., oxygen evolution measurements, fluorescence analysis, and thermoluminescence) can help identify the source of variability .

What challenges might researchers encounter when attempting to express multiple photosystem components for reconstitution studies?

Reconstitution studies involving multiple photosystem components present several challenges:

  • Stoichiometry control: Achieving appropriate ratios of different components requires careful optimization of expression levels or purification of individual components followed by controlled reassembly.

  • Assembly order: The sequence of component addition during reconstitution can significantly affect complex formation efficiency.

  • Lipid environment: Photosystem proteins function within specific membrane environments; the lipid composition used for reconstitution must support proper protein folding and function.

  • Cofactor incorporation: Chlorophylls, carotenoids, and other cofactors must be correctly integrated into the protein complex.

  • Functional validation: Ensuring that reconstituted complexes retain native functionality requires multiple analytical approaches.

To address these challenges, researchers should:

  • Express components with compatible tags to facilitate purification and assembly monitoring

  • Consider co-expression strategies where appropriate

  • Develop staged reconstitution protocols based on known assembly pathways

  • Utilize liposomes or nanodiscs with lipid compositions mimicking thylakoid membranes

  • Validate assembly using structural techniques (e.g., electron microscopy) and functional assays (e.g., electron transport measurements)

The complexity of these studies increases substantially when working with multiple protein isoforms or attempting to recreate dynamic regulatory processes observed in vivo .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.