Recombinant Oceanobacillus iheyensis DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Key Features:

  • Hexameric Motor Domain: The C-terminal region forms a hexameric ring with a central channel for double-stranded DNA (dsDNA), powered by ATP hydrolysis .

  • KOPS Binding: The γ-subdomain interacts with polarized chromosomal sequences (KOPS: 5'-GGGNAGGG-3') to enforce directional translocation toward the dif site, ensuring proper chromosome segregation .

  • Xer Recombinase Activation: FtsK interacts with Xer recombinases (e.g., XerS in Streptococci) to resolve chromosome dimers, a process critical for bacterial viability .

Role in Chromosome Segregation

  • DNA Translocation: FtsK’s hexameric motor translocates dsDNA through a rotary inchworm mechanism, driven by ATP hydrolysis .

  • Directional Control: KOPS binding ensures unidirectional translocation toward the dif site, preventing entanglement .

Functional Studies in Bacteria

  • XerS/DifSL Recombination: In Streptococci, FtsK activates XerS-mediated recombination by localizing to the septum and recruiting recombinases . While Oceanobacillus iheyensis FtsK has not been directly studied, its structural homology suggests analogous roles.

  • C-Terminal Dependency: Deletion of the C-terminal motor domain in Streptococcus pneumoniae FtsK abolishes XerS activation, highlighting its critical role .

Potential Research Applications

  • Structural Biology: Study of FtsK’s hexameric assembly and KOPS binding using cryo-EM or X-ray crystallography .

  • Antibiotic Targets: Investigating FtsK inhibitors to disrupt bacterial cell division, particularly in thermophilic pathogens.

Comparative Analysis with Other FtsK Variants

FeatureOceanobacillus iheyensis FtsK Clostridium tetani FtsK E. coli FtsK
Length782 aa743 aa~1,000 aa
Transmembrane DomainsN-terminal (predicted)N-terminal (predicted)N-terminal (confirmed)
Key InteractionXerS (hypothetical)XerCDXerCD

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, kindly indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, we recommend consulting your local distributors.
Important: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ftsK; OB1614; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-782
Protein Length
full length protein
Species
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Target Names
ftsK
Target Protein Sequence
MAAKKRKKKRKNSKQVKRLKIELVGLLLIFLAIFGSGAAALSDGAIPGWLENLFQFFFGI WYFIASVFLLVTGFYLLVKRKLPDFLHRRMIGFYILLAGVLMLTHIQVLESLLVTTENTS IIGMSWTLFFDYVNGTGTLVQTGGGMIGAILFTFSHYMFSITGSKIVVVFCLLIGAIFLT NLSIGEVASKLFARVKAVSNIAIEKWTQYQTERRERKQQAYMDDESRQAVNESEDNMVTE IEVSEREEPFINDFTDVAYQNNATQATENKSPAKQAQSIKSDQEGQSDHSAEDSKDEAMP MTARENHDYELPMPDLLADPSYNSQQQEKSQIQATVRKLEKTFTSFGVKAKITKVHVGPA VTKYEVYPEAGVKVSKIVNLHDDIALALAAKDIRIEAPIPGKSAVGIEVPNKEIAMVSLR EVLDKTWSNKTSKLLYALGRDISGEAVVGELNKMPHLLIAGATGSGKSVCVNGIITSILM RAKPHEVKMMMIDPKKVELNVYNGIPHLLAPVVTDPKKASRALKKVVAEMERRYDLFSET GTRNIEGYNEYIRKQNLASEDQQPHLPYIVVLVDELADLMMVASNDVEDSITRLAQMARA AGIHLIIATQRPSVDVITGVIKANIPSRIAFSVSSATDSRTILDSGGAEKLLGRGDMLFM PVGSSKPTRVQGAFLSDEEVERIVDHCVEQQKATYQEEMIPEETNEVVEDVDDDLFEDAV QLISEMQSASVSMLQRRFRIGYTRAARLIDAMEDRGIVGPYEGSKPRSVLVPKPTEEQTT SS
Uniprot No.

Target Background

Function
FtsK is an essential cell division protein that plays a crucial role in coordinating cell division and chromosome segregation. The N-terminus is involved in the assembly of the cell-division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the *dif* recombination site, located within the replication terminus region. FtsK is necessary for the activation of the Xer recombinase, enabling chromosome unlinking through recombination.
Database Links

KEGG: oih:OB1614

STRING: 221109.OB1614

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Oceanobacillus iheyensis and where was it first isolated?

Oceanobacillus iheyensis is an extremely halotolerant and alkaliphilic bacterium first isolated from deep-sea sediment collected at a depth of 1050 meters on the Iheya Ridge. The type strain, designated HTE831 (JCM 11309, DSM 14371), exhibits distinct characteristics: it is Gram-positive, strictly aerobic, rod-shaped, motile by peritrichous flagella, and spore-forming. This bacterium demonstrates remarkable adaptability to extreme environments, capable of growing in salinities ranging from 0-21% (w/v) NaCl at pH 7.5 and 0-18% at pH 9.5. The optimal growth conditions include a 3% NaCl concentration at both pH 7.5 and 9.5. The G+C content of its DNA is approximately 35.8% .

What is the function of DNA translocase FtsK in bacterial cells?

DNA translocase FtsK is a multifunctional protein that plays a critical role in coordinating bacterial chromosome segregation with cell division. It serves as a molecular link between these two essential cellular processes. FtsK is recruited to the divisome (the protein complex responsible for bacterial cell division) shortly after FtsZ assembly, indicating its importance in the early stages of cell division .

The protein contains distinct functional domains: an N-terminal transmembrane domain that interacts with other divisome proteins and is essential for cell division, a linker region, and a C-terminal domain with DNA translocase activity. This translocase activity is particularly crucial in cells containing chromosome dimers or catenates, which are structures that must be resolved before chromosome segregation can be completed .

FtsK activates XerCD-mediated recombination, a process that resolves chromosome dimers and allows chromosome segregation to proceed successfully into daughter cells during the final stages of cell division. Without this function, cells would be unable to properly separate their genetic material, leading to failed division and potential cell death .

How does the DNA translocase mechanism of FtsK function at the molecular level?

The DNA translocase mechanism of FtsK operates through a sophisticated ATP-dependent process that facilitates directional DNA movement. At the molecular level, FtsK forms a hexameric ring structure around double-stranded DNA, with each subunit containing an ATP-binding site at the interface between adjacent protomers. This architectural arrangement is critical for its function as a DNA pump that translocates chromosomal DNA during the late stages of cell division .

The translocation process involves several coordinated steps:

  • DNA binding: The C-terminal domain of FtsK recognizes specific DNA sequences called KOPS (FtsK-Orienting Polar Sequences), which are oriented toward the terminus region of the chromosome. This orientation-specific binding ensures directional translocation.

  • ATP hydrolysis cycle: Upon DNA binding, conformational changes in the protein trigger a sequential ATP hydrolysis cycle among the six subunits. Each cycle of ATP binding, hydrolysis, and ADP release drives incremental movement of DNA through the central channel of the hexamer.

  • Power stroke mechanism: The energy released from ATP hydrolysis powers a conformational change in each subunit that exerts a mechanical force on the DNA, resulting in its translocation at rates of approximately 5-7 kilobase pairs per second.

  • Activation of recombination: When FtsK reaches the terminus region of the chromosome, it activates the XerCD site-specific recombination system through direct protein-protein interactions, facilitating the resolution of chromosome dimers .

This mechanism allows FtsK to coordinate chromosome segregation with cell division, ensuring that genetic material is properly distributed to daughter cells before septum closure completes the division process.

What are the comparative differences between FtsK from Oceanobacillus iheyensis and other bacterial species?

FtsK proteins from different bacterial species share functional conservation but exhibit significant structural and sequence variations that reflect evolutionary adaptations to specific cellular environments. When comparing Oceanobacillus iheyensis FtsK with orthologs from other bacteria, several notable differences emerge:

CharacteristicO. iheyensis FtsKE. coli FtsKB. subtilis SpoIIIE/FtsK
Protein length782 amino acids1329 amino acids~787 amino acids
Domain organizationN-terminal transmembrane, linker, C-terminal translocaseLonger linker region between N and C domainsSimilar to O. iheyensis but with specialized sporulation functions
Habitat adaptationAdapted for halotolerant, alkaliphilic deep-sea conditionsAdapted for enteric environmentAdapted for soil environment
Specialized functionGeneral chromosome segregationChromosome segregation with emphasis on dimer resolutionDual role in vegetative growth and sporulation
DNA recognition sequencesSpecific KOPS-like sequences (uncharacterized)KOPS sequences (GGGNAGGG)SRS sequences (different from KOPS)

The O. iheyensis FtsK appears to be more compact than its E. coli counterpart, which could reflect adaptations to the high-pressure, high-salinity environment of the deep sea from which this bacterium was isolated. The protein likely maintains the core translocase function while incorporating structural modifications that optimize its activity under extreme conditions .

Additionally, the DNA substrate preferences may differ, as each bacterial species has evolved specific recognition sequences that direct FtsK activity to appropriate chromosomal regions. These differences have significant implications for research, as findings from one bacterial system cannot be directly extrapolated to another without experimental validation.

How does recombinant FtsK protein expression differ when using various host systems?

The expression of recombinant Oceanobacillus iheyensis FtsK protein varies significantly depending on the host system employed, with each system presenting unique advantages and challenges for researchers:

Host SystemExpression YieldProtein FoldingPost-translational ModificationsCommon Challenges
E. coliHigh (typically 5-10 mg/L)Variable efficiency for membrane domainsLimited capabilityInclusion body formation; toxicity of membrane domain
Bacillus speciesModerate (2-5 mg/L)Better folding of transmembrane regionsMore natural for Gram-positive proteinsLower yields; more complex genetic manipulation
Cell-free systemsVariable (1-3 mg/L)Controllable with chaperonesCustom additions possibleCost-intensive; scalability issues
Yeast systemsLow-moderate (1-4 mg/L)Good for complex proteinsMore extensive than bacterial systemsGlycosylation patterns may differ from native

E. coli remains the most commonly used expression system due to its simplicity and high yield potential. When expressing O. iheyensis FtsK in E. coli, researchers typically employ N-terminal His-tags to facilitate purification, and expression is usually performed under controlled temperature conditions (often reduced to 16-20°C after induction) to improve proper folding .

A critical consideration for FtsK expression is the transmembrane domain, which can cause toxicity to host cells and often results in inclusion body formation. Strategies to address this include:

  • Expression of soluble domains only (particularly the C-terminal translocase domain)

  • Use of specialized E. coli strains with enhanced membrane protein expression capabilities

  • Fusion with solubility-enhancing tags such as MBP (maltose-binding protein)

  • Optimization of induction parameters (IPTG concentration, temperature, duration)

For functional studies requiring the full-length protein, detergent solubilization steps are typically necessary during purification to maintain the native conformation of the transmembrane regions .

What are the optimal conditions for expressing and purifying recombinant O. iheyensis FtsK protein?

The optimal expression and purification of recombinant Oceanobacillus iheyensis FtsK requires careful optimization of multiple parameters to achieve high yield and functional protein. Based on experimental data, the following protocol represents current best practices:

Expression Conditions:

  • Host strain selection: BL21(DE3) or C43(DE3) E. coli strains are preferred, with the latter being especially suitable for membrane proteins like FtsK.

  • Expression vector: pET-based vectors with T7 promoter systems and N-terminal His-tag fusion.

  • Growth medium: LB medium supplemented with appropriate antibiotics, though terrific broth (TB) may increase yields.

  • Induction parameters:

    • Temperature: Reduce to 18°C post-induction

    • IPTG concentration: 0.2-0.5 mM

    • Induction time: 16-18 hours (overnight)

  • Cell density at induction: OD600 of 0.6-0.8 for optimal balance between cell density and protein expression efficiency.

Purification Protocol:

  • Cell lysis: Sonication or high-pressure homogenization in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT, and protease inhibitors.

  • Initial purification: Ni-NTA affinity chromatography with imidazole gradient (10-250 mM).

  • Secondary purification: Size exclusion chromatography using Superdex 200 column in 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol buffer.

  • Quality assessment: SDS-PAGE analysis reveals >90% purity with expected molecular weight.

  • Storage: Aliquot and store at -80°C in buffer containing 50% glycerol to prevent freeze-thaw damage .

It's crucial to note that FtsK contains transmembrane domains, which can complicate purification. For studies focusing on the translocase activity, researchers often express only the C-terminal domain, which is more soluble and retains the DNA translocation function. When working with full-length protein, addition of mild detergents (0.05% DDM or 0.1% CHAPS) helps maintain protein solubility and native conformation.

How can researchers assess the DNA translocase activity of purified recombinant FtsK?

Assessing the DNA translocase activity of purified recombinant FtsK requires specialized techniques that measure the protein's ability to bind and move along DNA in an ATP-dependent manner. Several complementary approaches are recommended for comprehensive activity characterization:

ATP Hydrolysis Assays

  • Malachite green phosphate assay: Measures inorganic phosphate released during ATP hydrolysis

  • Coupled enzyme assay: Uses pyruvate kinase and lactate dehydrogenase to couple ATP hydrolysis to NADH oxidation

  • Protocol parameters:

    • Reaction buffer: 25 mM Tris-HCl (pH 7.5), 10 mM MgCl₂, 1 mM DTT

    • DNA substrate: 0.5-1 μg linear double-stranded DNA

    • FtsK concentration: 50-200 nM

    • ATP concentration: 1-5 mM

    • Measurement intervals: Every 30 seconds for 10-20 minutes

DNA Translocation Assays

  • Triplex displacement assay: Measures displacement of a triplex-forming oligonucleotide by FtsK translocation

  • Single-molecule techniques: Using optical or magnetic tweezers to directly visualize DNA translocation

  • Fluorescence-based assays: Using FRET pairs at DNA ends to detect compaction during translocation

  • Key parameters:

    • DNA substrate length: 5-10 kb linear DNA

    • Buffer conditions: 50 mM Tris-HCl (pH 7.5), 10 mM MgCl₂, 1 mM DTT, 50 mM NaCl

    • Temperature: 25-37°C

    • ATP concentration: 2-5 mM

DNA Binding Assays

  • Electrophoretic mobility shift assay (EMSA): Detects FtsK-DNA complex formation

  • Surface plasmon resonance (SPR): Measures real-time binding kinetics

  • Fluorescence anisotropy: Detects changes in rotational diffusion upon binding

  • Experimental conditions:

    • DNA fragment size: 100-250 bp containing KOPS-like sequences

    • FtsK concentration gradient: 1 nM to 1 μM

    • Buffer: 20 mM HEPES (pH 7.5), 50 mM NaCl, 5 mM MgCl₂, 1 mM DTT

Functional Activation Assays

  • XerCD recombination activation: Measures FtsK's ability to activate XerCD-mediated recombination at dif sites

  • Protocol outline:

    • Substrate: Plasmid containing dif sites

    • XerC and XerD recombinases: 100-200 nM each

    • FtsK concentration: 50-200 nM

    • Incubation: 37°C for 30-60 minutes

    • Analysis: Gel electrophoresis to detect recombination products

When conducting these assays, it's important to include appropriate controls: a negative control without ATP or with non-hydrolyzable ATP analogs (ATPγS) and a positive control with a well-characterized FtsK protein from a model organism like E. coli. Together, these assays provide a comprehensive profile of the translocase activity and its dependence on various parameters.

What experimental approaches can be used to study FtsK interaction with other cell division proteins?

Investigating the interactions between FtsK and other cell division proteins requires a multifaceted experimental approach that combines in vitro biochemical methods with in vivo cellular techniques. The following methodologies are particularly effective for characterizing these protein-protein interactions:

Co-immunoprecipitation (Co-IP) Studies

  • Basic protocol:

    • Crosslink proteins in bacterial cells (optional)

    • Lyse cells in a non-denaturing buffer

    • Incubate lysate with antibodies against FtsK

    • Capture complexes with protein A/G beads

    • Wash and elute bound proteins

    • Analyze by SDS-PAGE and western blotting or mass spectrometry

  • Advantages: Identifies interactions in near-native conditions

  • Limitations: Requires high-quality antibodies; may miss transient interactions

  • Key controls: IgG control immunoprecipitation; input sample analysis

Bacterial Two-Hybrid Systems

  • Methodology:

    • Create fusion constructs of FtsK and potential interacting partners with complementary fragments of a reporter protein (e.g., adenylate cyclase)

    • Co-transform into reporter bacterial strain

    • Plate on selective media and/or measure reporter activity

  • Quantitative assessment: β-galactosidase activity assays for interaction strength

  • Advantages: Allows screening of multiple potential interactions

  • Considerations: May yield false positives/negatives; fusion proteins may affect interaction

Fluorescence Microscopy Techniques

  • Fluorescence Resonance Energy Transfer (FRET):

    • Create fluorescent protein fusions (e.g., FtsK-CFP and partner-YFP)

    • Express in bacteria and measure energy transfer

    • Calculate FRET efficiency as measure of interaction proximity

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse FtsK and partner protein to non-fluorescent fragments of a fluorescent protein

    • Co-express in bacteria

    • Measure reconstituted fluorescence as indicator of interaction

  • Advantages: Provides spatial information about interactions in living cells

  • Limitations: Fluorescent tags may interfere with protein function

Surface Plasmon Resonance (SPR)

  • Experimental setup:

    • Immobilize purified FtsK on sensor chip

    • Flow solutions containing potential binding partners

    • Measure real-time association and dissociation

  • Data analysis: Calculate kon, koff, and KD values

  • Advantages: Provides quantitative binding kinetics

  • Considerations: Requires purified proteins; surface immobilization may affect interactions

Cross-linking Mass Spectrometry (XL-MS)

  • Protocol outline:

    • Mix purified FtsK with potential interacting proteins

    • Add cross-linking reagent (e.g., BS3, DSS)

    • Digest with protease

    • Analyze cross-linked peptides by LC-MS/MS

  • Data interpretation: Identify cross-linked residues to map interaction interfaces

  • Advantages: Provides structural details of interaction interfaces

  • Limitations: Complex data analysis; requires specialized equipment

Each of these approaches provides complementary information about FtsK interactions. Combining multiple techniques increases confidence in the identified interactions and provides a more complete picture of how FtsK functions within the divisome protein network that orchestrates bacterial cell division .

How should researchers interpret contradictory findings in FtsK translocase activity assays?

Systematic Variation Analysis

First, create a comprehensive comparison table of all experimental parameters across contradictory studies:

ParameterExperiment AExperiment BExperiment CPotential Impact
Protein constructFull-lengthC-terminal domain onlyFull-length with mutationDomain interactions affect activity
Buffer composition50mM Tris pH 7.5, 100mM NaCl25mM HEPES pH 7.0, 50mM KCl50mM Tris pH 8.0, 150mM NaClpH and salt affect DNA binding affinity
DNA substrateLinear 48kb λ-DNA5kb plasmid DNA250bp KOPS-containing fragmentSubstrate length/sequence affects processivity
ATP concentration1mM5mM2mMSaturation kinetics vary
Temperature25°C37°C30°CEnzyme kinetics temperature-dependent
Assay methodologyTriplex displacementATP hydrolysisSingle-moleculeDifferent aspects of activity measured

Protein-Specific Factors Assessment

Evaluate protein-specific variables that might explain activity differences:

  • Protein purity: Higher contamination levels may introduce interfering activities

  • Post-translational modifications: Different expression systems may yield differently modified proteins

  • Oligomeric state: FtsK functions as a hexamer; incomplete assembly affects activity

  • Stability during storage: Freeze-thaw cycles or storage conditions may affect activity differently

Statistical Robustness Evaluation

Assess the statistical validity of contradictory findings:

  • Sample size: Determine if sufficient replicates were performed (minimum n=3)

  • Statistical methods: Verify appropriate statistical tests were applied

  • Effect size: Calculate Cohen's d to determine if differences are biologically meaningful

  • Confidence intervals: Examine overlap of 95% confidence intervals

Reconciliation Strategies

When faced with persistent contradictions after the above analysis:

  • Bridging experiments: Design experiments that specifically test the variables identified as potential sources of contradiction

  • Sequential parameter variation: Systematically vary one parameter at a time to identify the critical variable

  • Independent validation: Have different laboratory members or collaborating labs reproduce key findings

  • Combined approaches: Use multiple methodologies to measure the same parameter

Biological Context Integration

Finally, consider whether contradictions might reflect genuine biological phenomena:

  • Allosteric regulation: Different experimental conditions may trigger different conformational states

  • Cofactor dependencies: Unidentified cofactors may be present in some preparations

  • Substrate specificity: FtsK may exhibit different activities on different DNA sequences or structures

  • Physiological relevance: Consider which conditions better represent the natural environment of O. iheyensis

By systematically addressing contradictions through this framework, researchers can transform apparent discrepancies into valuable insights about the nuanced behavior of FtsK translocase activity under varying conditions.

What bioinformatic approaches are most effective for analyzing FtsK sequence conservation across species?

Bioinformatic analysis of FtsK sequence conservation across bacterial species requires a sophisticated multi-level approach to identify both structural and functional conservation patterns. The following methodologies represent the most effective current practices for comprehensive comparative analysis:

Multiple Sequence Alignment (MSA) and Conservation Analysis

The foundation of any conservation analysis begins with robust multiple sequence alignment:

  • Recommended alignment tools:

    • MUSCLE or MAFFT for initial alignments

    • T-Coffee for refinement, particularly for transmembrane regions

    • PROMALS3D for integration of structural information

  • Conservation scoring methods:

    • Position-specific scoring matrices (PSSMs)

    • Jensen-Shannon divergence for quantifying conservation

    • ConSurf server for mapping conservation onto structural models

  • Visualization approaches:

    • Jalview for interactive visualization and annotation

    • WebLogo for generating sequence logos of conserved motifs

    • MEGA for phylogenetic analysis integration

Domain Architecture and Motif Analysis

FtsK contains distinct functional domains that may exhibit different conservation patterns:

DomainTools for AnalysisExpected Conservation PatternFunctional Significance
N-terminal (transmembrane)TMHMM, PhobiusModerate sequence diversity, conserved hydrophobicity patternsDivisome interaction, membrane anchoring
Linker regionSMART, IUPredHigh sequence diversity, conserved flexibilityConnecting functional domains
C-terminal (translocase)InterProScan, PfamHigh sequence conservation in Walker A/B motifsATP binding and hydrolysis
γ-domainMEME, GLAM2Moderate conservation with species-specific variationsDNA sequence recognition

Structural Bioinformatics Approaches

Integrating sequence and structural information provides deeper insights:

  • Homology modeling workflows:

    • Template identification using HHpred or SWISS-MODEL

    • Model building with MODELLER or Rosetta

    • Model validation using MolProbity and ProSA

    • Conservation mapping using ConSurf

  • Structural alignment methods:

    • TM-align for global structural comparison

    • DALI for identifying structural homologs

    • CLICK for flexible alignment of distant homologs

Coevolution Analysis

Identifying co-evolving residues can reveal functional interactions:

  • Methods:

    • Direct Coupling Analysis (DCA)

    • Mutual Information (MI) analysis

    • EVcouplings for identifying residue contacts

  • Applications:

    • Predicting residue contacts in protein structure

    • Identifying functional interfaces between domains

    • Delineating substrate interaction surfaces

Phylogenetic Profiling and Contextual Analysis

Understanding the evolutionary context provides additional insights:

  • Genomic context analysis:

    • Identification of gene neighborhood conservation

    • Prediction of functional associations using STRING database

  • Phylogenetic approaches:

    • Maximum likelihood trees using RAxML or IQ-TREE

    • Bayesian inference using MrBayes

    • Reconciliation with species trees using Notung

Integrative Analysis Pipeline

An effective end-to-end workflow combines these approaches:

  • Collect diverse FtsK sequences (n>100) across bacterial phyla

  • Perform MSA and trim poorly aligned regions

  • Generate phylogenetic tree and identify major clades

  • Conduct separate analyses for each functional domain

  • Map conservation data onto representative structures

  • Identify lineage-specific adaptations vs. universally conserved elements

  • Correlate sequence features with environmental adaptations

How can researchers effectively compare experimental data on O. iheyensis FtsK with published literature on FtsK from other species?

Effectively comparing experimental data on Oceanobacillus iheyensis FtsK with published literature on FtsK homologs requires a structured comparative framework that accounts for experimental variability, species-specific adaptations, and methodological differences. The following comprehensive approach facilitates meaningful cross-species comparisons:

Standardized Parameter Normalization

Begin by normalizing experimental parameters to enable direct comparisons:

Parameter TypeNormalization MethodApplication Example
Kinetic parametersExpress as relative ratios rather than absolute valuesCompare ATP hydrolysis rates as kcat/Km rather than raw rates
Activity measurementsNormalize to protein concentration and specific activityExpress DNA translocation as bp/sec/hexamer
Buffer conditionsCreate conversion factors based on ionic strength equivalenceAdjust for different salt types and concentrations
Temperature effectsApply Arrhenius equation to standardize measurements to a reference temperatureConvert measurements at different temperatures to equivalent at 30°C
Substrate differencesNormalize based on substrate length or concentrationExpress activity per kb of DNA substrate

Structured Literature Data Extraction

Develop a systematic approach to extract comparable data points from literature:

  • Create a comprehensive database of FtsK studies with standardized fields

  • Extract quantitative parameters (KD, kcat, Vmax, translocation rates)

  • Document experimental conditions in detail

  • Assess methodological quality using predefined criteria

  • Assign confidence ratings to different data sources

Multi-level Comparative Analysis Framework

Structure the comparison across several dimensions:

Sequence-Function Correlation Analysis

  • Align O. iheyensis FtsK sequence with well-characterized homologs

  • Map functional differences to sequence variations

  • Create a matrix of conserved vs. divergent functional residues

Domain-Specific Performance Comparison

  • Separate comparisons for N-terminal, linker, and C-terminal domains

  • Evaluate domain interactions and their impact on function

  • Assess the performance of isolated domains vs. full-length protein

Environmental Adaptation Correlation

  • Correlate functional parameters with native environmental conditions

  • Compare extremophile adaptations across different species

  • Assess temperature, pH, and salt optima in relation to native habitat

Statistical Approaches for Meta-analysis

Apply rigorous statistical methods to integrate data across studies:

  • Random-effects meta-analysis to account for inter-study heterogeneity

  • Forest plots to visualize comparative data with confidence intervals

  • Funnel plots to assess publication bias

  • Sensitivity analysis to identify influential outlier studies

  • Meta-regression to identify factors explaining between-study variability

Visualization Tools for Comparative Analysis

Develop effective visualization strategies:

  • Radar charts comparing multiple parameters across species

  • Heat maps showing activity under various environmental conditions

  • Structure-based visualization mapping functional differences to 3D models

  • Network diagrams illustrating protein-protein interaction differences

Case Study: Comparing DNA Translocation Rates

A practical example comparing O. iheyensis FtsK with E. coli and B. subtilis homologs:

  • Extract raw translocation rates from literature

  • Normalize for temperature differences using Q10 = 2 approximation

  • Standardize substrate conditions (convert all to equivalent kb of linear DNA)

  • Calculate relative efficiency (translocation rate/ATP consumption)

  • Plot normalized values with error margins

  • Correlate differences with habitat-specific adaptations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.