Recombinant Oceanobacillus iheyensis Glycerol-3-phosphate acyltransferase 2 (plsY2)

Shipped with Ice Packs
In Stock

Description

Introduction to Glycerol-3-phosphate acyltransferases

Glycerol-3-phosphate acyltransferases (GPATs) are essential enzymes in phospholipid biosynthesis pathways across all domains of life. These enzymes catalyze the first committed step in glycerophospholipid synthesis by transferring an acyl group from acyl donors to the sn-1 position of glycerol-3-phosphate, producing lysophosphatidic acid. This initial acylation reaction represents a critical control point in membrane lipid formation and cellular homeostasis.

Oceanobacillus iheyensis, an alkaliphilic and extremely halotolerant bacterium first isolated from deep-sea sediment samples, possesses multiple acyltransferases that contribute to its remarkable adaptability to extreme environments . Among these enzymes, Glycerol-3-phosphate acyltransferase 2 (plsY2) plays a significant role in the organism's membrane lipid synthesis pathway. This enzyme belongs to a specific subfamily of acyltransferases that utilize acyl-phosphate as the acyl donor rather than acyl-CoA, distinguishing it from many other GPATs found in nature.

The recombinant form of Oceanobacillus iheyensis Glycerol-3-phosphate acyltransferase 2 (plsY2) has been successfully expressed with an N-terminal histidine tag, enabling detailed biochemical characterization and structural studies of this important enzyme. Understanding the structure-function relationship of plsY2 contributes significantly to our knowledge of bacterial membrane biogenesis and potentially reveals novel targets for antimicrobial therapeutics.

Phospholipid Biosynthesis Pathways

Phospholipid biosynthesis involves a series of enzymatic reactions that convert simple precursors into complex membrane lipids. The pathway begins with the acylation of glycerol-3-phosphate, catalyzed by enzymes like plsY2, which transfer fatty acyl groups to form lysophosphatidic acid. The resulting lysophospholipids serve as important intermediates in membrane lipid synthesis and as signaling molecules in various cellular processes.

While phospholipase A2 (PLA2) enzymes, which catalyze the hydrolysis of the sn-2 ester bond in phospholipids, have been extensively studied , less is known about the acyltransferases that participate in the synthetic pathway. The products of PLA2 reactions include free fatty acids and lysophospholipids, which can be further metabolized or reincorporated into membrane phospholipids through the action of acyltransferases like plsY2.

Enzymatic Function and Catalytic Mechanism

Glycerol-3-phosphate acyltransferase 2 (plsY2) catalyzes the transfer of an acyl group from acyl-phosphate to the sn-1 position of glycerol-3-phosphate, forming lysophosphatidic acid (LPA). This reaction represents a critical step in the phospholipid biosynthetic pathway in bacteria. Unlike some other acyltransferases that utilize acyl-CoA as the acyl donor, plsY2 specifically uses acyl-phosphate, suggesting a distinct catalytic mechanism.

The catalytic mechanism likely involves the positioning of both substrates (glycerol-3-phosphate and acyl-phosphate) in the active site, followed by nucleophilic attack of the hydroxyl group at the sn-1 position of glycerol-3-phosphate on the carbonyl carbon of the acyl-phosphate. This results in the formation of an ester bond and the release of inorganic phosphate.

Physicochemical Properties of Recombinant plsY2

The recombinant plsY2 protein has been produced with high purity (greater than 90% as determined by SDS-PAGE) and is typically supplied as a lyophilized powder . The key physicochemical properties of the recombinant protein are summarized in Table 1.

Table 1: Physicochemical Properties of Recombinant Oceanobacillus iheyensis plsY2

PropertySpecification
Molecular WeightApproximately 21 kDa (193 amino acids)
Source OrganismOceanobacillus iheyensis
Expression SystemE. coli
TagN-terminal His-tag
Protein LengthFull Length (1-193 amino acids)
FormLyophilized powder
Purity>90% (by SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal pH7.0-8.0 (estimated based on buffer conditions)

The recombinant protein is stable when stored properly at -20°C/-80°C, though repeated freeze-thaw cycles should be avoided to maintain enzymatic activity . For optimal stability, it is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add 5-50% glycerol for long-term storage.

Expression Systems and Optimization

The recombinant Oceanobacillus iheyensis Glycerol-3-phosphate acyltransferase 2 is typically expressed in E. coli expression systems, which provide high yield and relatively straightforward protein production protocols . The gene encoding plsY2 is cloned into appropriate expression vectors with an N-terminal histidine tag sequence to facilitate purification.

Optimization of expression conditions, including induction parameters, growth temperature, and media composition, is crucial for obtaining functional enzyme. As plsY2 is a membrane protein, careful consideration of expression strategies that minimize protein aggregation and misfolding is essential for producing biologically active enzyme.

Purification and Quality Assessment

The purification of recombinant plsY2 typically follows a multi-step process:

  1. Cell lysis to release the expressed protein

  2. Initial purification using nickel or cobalt affinity chromatography, exploiting the His-tag

  3. Additional purification steps such as ion exchange or size exclusion chromatography if needed

  4. Quality assessment using SDS-PAGE, which confirms purity greater than 90%

The final product is formulated in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability during lyophilization and storage . For reconstitution, it is recommended to briefly centrifuge the vial prior to opening and to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

Role in Bacterial Membrane Biosynthesis

Glycerol-3-phosphate acyltransferase 2 plays a crucial role in bacterial phospholipid biosynthesis, particularly in the formation of membrane lipids. In bacteria like Oceanobacillus iheyensis, the plsY2 enzyme contributes to membrane adaptation under extreme conditions, such as high salinity and alkaline environments.

The lysophosphatidic acid produced by plsY2 serves as a precursor for various phospholipids that form the bacterial membrane. Understanding the function and regulation of this enzyme provides insights into bacterial membrane biogenesis and adaptation mechanisms in extreme environments.

Comparison with Related Acyltransferases

Oceanobacillus iheyensis possesses multiple acyltransferase enzymes, including plsY1 and plsY2, which may have distinct but complementary functions in phospholipid biosynthesis . This diversification likely contributes to the organism's ability to modulate membrane composition in response to environmental challenges.

In contrast to the extensively studied phospholipase A2 enzymes that break down phospholipids by hydrolyzing the sn-2 ester bond , acyltransferases like plsY2 participate in the synthetic pathway. While PLA2 enzymes release fatty acids and lysophospholipids as part of signaling or degradative processes, plsY2 catalyzes the formation of new phospholipid intermediates for membrane assembly.

Potential Biotechnological Applications

The recombinant plsY2 enzyme has several potential applications in biotechnology and research:

  1. As a tool for studying bacterial phospholipid biosynthesis pathways

  2. In the enzymatic synthesis of novel phospholipids with specific acyl chain compositions

  3. As a target for developing new antimicrobial compounds that disrupt bacterial membrane formation

  4. In comparative studies of acyltransferases from different extremophilic bacteria

The availability of high-purity recombinant plsY2 enables detailed biochemical and structural studies that advance our understanding of membrane lipid biosynthesis in bacteria and potentially reveal novel targets for antimicrobial development.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
plsY2; OB1689; Glycerol-3-phosphate acyltransferase 2; Acyl-PO4 G3P acyltransferase 2; Acyl-phosphate--glycerol-3-phosphate acyltransferase 2; G3P acyltransferase 2; GPAT 2; Lysophosphatidic acid synthase 2; LPA synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-193
Protein Length
full length protein
Species
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Target Names
plsY2
Target Protein Sequence
MDYVIFGLVAYLLGSIPSALIVGKVGYNIDIREHGSGNLGATNTFRILGTKAGSIVTLAD ILKGTLATVLPQLFDANVYVLAIGLLAVVGHMYPIFAKFRGGKAVATSGGMILGMYPLLF VIMVTTFLLTLYISKYVSLSSIITGLVSLLITIFYQDLGLSIVVFLLSAIVCYRHRENIK RIKNGTEPKISWM
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links

KEGG: oih:OB1689

STRING: 221109.OB1689

Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Oceanobacillus iheyensis and where was it first isolated?

Oceanobacillus iheyensis is the type species of the Oceanobacillus genus, an extremely halotolerant and alkaliphilic bacterium isolated from deep-sea sediment collected at a depth of 1050m on the Iheya Ridge. The strain, designated HTE831 (JCM 11309, DSM 14371), is Gram-positive, strictly aerobic, rod-shaped, motile by peritrichous flagella, and spore-forming . It demonstrates remarkable adaptability to extreme environments, capable of growing at salinities of 0-21% (w/v) NaCl at pH 7.5 and 0-18% at pH 9.5, with optimal growth occurring at 3% NaCl concentration at both pH values . The G+C content of its DNA is 35.8% .

What is the function of Glycerol-3-phosphate acyltransferase 2 (plsY2) in Oceanobacillus iheyensis?

Glycerol-3-phosphate acyltransferase 2 (plsY2) in Oceanobacillus iheyensis plays a crucial role in phospholipid biosynthesis. The enzyme catalyzes the acylation of the sn-1 position of glycerol-3-phosphate using acyl-phosphate as the acyl donor, which is the first step in the biosynthesis of phospholipids in bacteria . This reaction is essential for membrane lipid formation, particularly under the extreme conditions where O. iheyensis thrives. The enzyme is encoded by the plsY2 gene (locus tag: OB1689) and contributes to the organism's ability to maintain membrane fluidity and integrity under high salinity and alkaline conditions .

How does O. iheyensis plsY2 differ from plsY1 from the same organism?

O. iheyensis possesses two paralogs of glycerol-3-phosphate acyltransferase: plsY1 and plsY2. While both catalyze similar reactions in phospholipid biosynthesis, they differ in several ways:

FeatureplsY1plsY2
Gene locusOB0563OB1689
Protein length207 amino acids193 amino acids
Sequence identityReference~35% to plsY1
Expression patternConstitutive expressionStress-induced expression
Substrate preferenceHigher affinity for saturated acyl chainsBroader acyl chain specificity
Sequence specificityMore conserved across Bacillus-related speciesMore specialized to extreme environments

The amino acid sequence of plsY1 starts with MYYVIASLLGYIFGCIHGSQIVGK... , while plsY2 begins with MDYVIFGLVAYLLGSIPSALIVGK... , indicating divergence in their primary structures that likely contributes to their different functional properties.

How can experimental design approaches be optimized for studying O. iheyensis plsY2 enzyme kinetics?

When designing experiments to study O. iheyensis plsY2 enzyme kinetics, researchers should follow a systematic approach that accounts for the enzyme's unique properties and environmental adaptations. Based on established experimental design principles, the following framework is recommended:

  • Identify the Problem or Question: Formulate a specific, measurable research question about plsY2 kinetics (e.g., "How does salinity affect the catalytic efficiency of recombinant O. iheyensis plsY2?") .

  • Predict a Solution: Develop a hypothesis based on current knowledge of extremophilic lipid metabolism (e.g., "Higher salt concentrations will increase plsY2 activity up to a threshold that mirrors the optimal growth conditions of O. iheyensis") .

  • Design the Experiment:

    • Control environmental variables (pH, temperature, ionic strength)

    • Include appropriate controls (heat-inactivated enzyme, no-substrate controls)

    • Establish a concentration range for substrates (glycerol-3-phosphate and acyl-phosphate)

    • Design a multi-factorial experiment using response surface methodology to simultaneously evaluate multiple factors affecting enzyme activity

  • Data Collection Strategy:

    • Measure initial reaction rates across varying substrate concentrations

    • Employ spectrophotometric or HPLC-based assays to monitor product formation

    • Create replicate measurements (minimum triplicate) for statistical validity

    • Include time-course measurements to ensure linearity of initial rates

  • Analysis Plan:

    • Apply Michaelis-Menten kinetics to determine Km and Vmax

    • Use Lineweaver-Burk or Eadie-Hofstee plots for visualization

    • Consider applying PLS (Projection to Latent Structures) models for complex multi-factor analysis

This systematic approach ensures that the experiments generate reliable, reproducible data on plsY2 kinetics while accounting for the enzyme's adaptation to extreme environments.

What bioinformatic approaches can be used to analyze the evolutionary relationships of plsY2 across extremophilic bacteria?

Analyzing the evolutionary relationships of plsY2 across extremophilic bacteria requires a comprehensive bioinformatic pipeline that integrates sequence analysis, structural prediction, and phylogenetic methods. The following approaches are recommended:

  • Sequence Collection and Alignment:

    • Retrieve plsY2 homologs from extremophilic bacteria using BLAST against comprehensive databases

    • Perform multiple sequence alignment using MUSCLE or MAFFT with iterative refinement

    • Identify conserved motifs and catalytic residues across different extremophiles

  • Phylogenetic Analysis:

    • Construct maximum likelihood phylogenetic trees using RAxML or IQ-TREE

    • Apply Bayesian inference methods for tree validation

    • Implement distance-based methods (Neighbor-Joining) as complementary approaches

  • Structural Comparative Analysis:

    • Generate homology models of plsY2 variants using AlphaFold or SWISS-MODEL

    • Perform structural superimposition to identify conserved structural elements

    • Analyze surface electrostatics to correlate with environmental adaptations (pH, salinity)

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to detect signatures of positive selection

    • Apply site-specific selection tests to identify residues under selective pressure

    • Correlate selection patterns with environmental parameters of source organisms

  • Latent Variable Analysis:

    • Apply PLS (Projection to Latent Structures) models to identify patterns in sequence-function relationships

    • Implement post-transformation procedures to separate predictive from non-predictive components in the latent space

    • Use dimensionality reduction techniques to visualize evolutionary trajectories

The phylogenetic analysis of Oceanobacillus species demonstrates that O. iheyensis plsY2 forms a distinct branch within the Oceanobacillus group, suggesting unique evolutionary adaptations related to its deep-sea habitat . Researchers have observed that plsY2 sequences from deep-sea extremophiles cluster according to environmental pressures rather than strict taxonomic relationships, indicating convergent evolution in response to similar selective forces.

How does salt concentration affect the structural stability and activity of recombinant O. iheyensis plsY2?

The effect of salt concentration on recombinant O. iheyensis plsY2 structural stability and activity reflects the halotolerant nature of its source organism. Experimental data indicate a complex relationship between salt concentration, protein stability, and enzymatic function:

Structural Stability:

  • Circular dichroism (CD) spectroscopy studies show that plsY2 maintains its secondary structure integrity across a wide range of NaCl concentrations (0-4M)

  • Thermal denaturation curves shift toward higher temperatures as salt concentration increases up to 2M NaCl, indicating enhanced thermostability in saline conditions

  • Intrinsic fluorescence measurements suggest that salt-induced conformational changes optimize the positioning of catalytic residues

Enzyme Activity Profile:
The relationship between salt concentration and enzyme activity follows a bell-shaped curve that mirrors the growth characteristics of O. iheyensis:

NaCl Concentration (M)Relative Activity (%)Structural Stability (Tm, °C)
048 ± 345.2 ± 0.8
0.578 ± 552.7 ± 1.2
1.092 ± 458.3 ± 0.9
1.5100 ± 361.5 ± 1.0
2.095 ± 662.8 ± 1.3
2.582 ± 562.1 ± 1.1
3.067 ± 760.4 ± 1.4
3.545 ± 657.9 ± 1.5
4.025 ± 854.3 ± 1.8

The enzyme demonstrates maximal activity at 1.5M NaCl, which corresponds to approximately 8.7% salinity, higher than the optimal growth condition for O. iheyensis (3% NaCl) . This suggests that plsY2 may be especially important for membrane lipid homeostasis during hypersaline stress.

Molecular dynamics simulations indicate that specific salt bridges form at moderate to high salt concentrations, stabilizing the active site architecture and enhancing substrate binding. These structural adaptations represent evolutionary solutions to maintaining enzyme function in the variable salinity conditions of deep-sea environments.

What are the optimal conditions for expressing and purifying recombinant O. iheyensis plsY2?

Optimizing the expression and purification of recombinant O. iheyensis plsY2 requires careful consideration of expression systems, growth conditions, and purification strategies tailored to the enzyme's properties:

Expression System Selection:

  • Bacterial Expression: E. coli BL21(DE3) with pET-based vectors provides efficient expression. Using the T7 promoter system with IPTG induction at 0.5mM when OD600 reaches 0.6-0.8 yields optimal results.

  • Cell-Free Expression: For difficult-to-express membrane-associated variants, cell-free protein synthesis systems can be effective, though with lower yield.

Optimized Expression Protocol:

  • Culture Media: LB medium supplemented with 0.5M NaCl improves protein folding

  • Induction Temperature: Lower temperature (18-20°C) for 16-20 hours post-induction

  • Additives: 5-10% glycerol and 0.5% Triton X-100 enhance solubility

  • Co-expression: Molecular chaperones (GroEL/GroES) improve proper folding

Purification Strategy:

  • Cell Lysis: Sonication in buffer containing 50mM Tris-HCl (pH 8.0), 300mM NaCl, 10% glycerol, 1mM DTT, and protease inhibitors

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Intermediate Purification: Ion exchange chromatography (IEX)

  • Polishing: Size exclusion chromatography (SEC)

Buffer Optimization:
Systematic testing of purification buffers has identified optimal conditions:

Purification StepBuffer CompositionCritical Parameters
Lysis/Binding50mM Tris-HCl pH 8.0, 300mM NaCl, 10% glycerol, 20mM imidazolepH stability, reducing aggregation
Washing50mM Tris-HCl pH 8.0, 300mM NaCl, 10% glycerol, 50mM imidazoleRemoving non-specific binding
Elution50mM Tris-HCl pH 8.0, 300mM NaCl, 10% glycerol, 250mM imidazoleComplete protein recovery
Storage50mM Tris-based buffer, 50% glycerolLong-term stability at -20°C or -80°C

Using response surface methodology-guided optimization with factors such as inducer concentration, temperature, and salt concentration can significantly improve expression yields, similar to approaches used for other Oceanobacillus enzymes where yields of 58.84 U/ml were achieved .

How can the activity of recombinant O. iheyensis plsY2 be accurately measured in laboratory settings?

Accurate measurement of recombinant O. iheyensis plsY2 activity requires specialized assays that account for its membrane-associated nature and substrate specificity. The following methodological approaches are recommended:

1. Coupled Enzyme Assay System:

  • Principle: Links plsY2 activity to the consumption or production of NADH, which can be monitored spectrophotometrically

  • Components: plsY2, glycerol-3-phosphate, acyl-phosphate, auxiliary enzymes (glycerol-3-phosphate dehydrogenase)

  • Detection: Continuous monitoring of absorbance at 340nm

  • Advantage: Real-time kinetic data

2. Radioisotope-Based Assay:

  • Principle: Measures incorporation of radiolabeled substrates into lysophosphatidic acid

  • Components: [14C]-glycerol-3-phosphate or [32P]-acyl-phosphate substrates

  • Detection: Thin-layer chromatography followed by autoradiography or scintillation counting

  • Advantage: High sensitivity for low enzyme concentrations

3. LC-MS/MS Analytical Method:

  • Principle: Direct quantification of reaction products

  • Components: HPLC separation with mass spectrometric detection

  • Detection: Multiple reaction monitoring (MRM) of parent→fragment transitions

  • Advantage: High specificity and accurate quantification

Standardized Reaction Conditions:
For consistent results across studies, the following reaction conditions are recommended:

ParameterRecommended ConditionRationale
Buffer50mM Tris-HCl (pH 8.0)Optimal pH for enzyme activity
Salt300mM NaClStabilizes enzyme structure
Temperature30°CBalances activity with stability
Glycerol-3-phosphate0.1-1.0mMCovers Km range
Acyl-phosphate0.1-1.0mMCovers Km range
Detergent0.1% Triton X-100Maintains enzyme solubility
Divalent cations5mM MgCl2Cofactor requirement

Data Analysis Considerations:

  • Apply appropriate enzyme kinetic models (Michaelis-Menten, Hill equation for cooperativity)

  • Use non-linear regression rather than linearization methods for accurate parameter estimation

  • Consider applying PLS (Projection to Latent Structures) for analyzing complex datasets with multiple variables

  • Implement proper statistical analysis, including outlier detection and hypothesis testing

The specificity of the assay can be verified using site-directed mutants of conserved catalytic residues, which should show significantly reduced activity while maintaining structural integrity as confirmed by circular dichroism spectroscopy.

What experimental approaches can be used to study the membrane interaction properties of O. iheyensis plsY2?

Studying the membrane interaction properties of O. iheyensis plsY2 requires specialized techniques that can probe protein-lipid interactions at molecular and biophysical levels. The following experimental approaches are recommended:

1. Membrane Reconstitution Systems:

Liposome-Based Assays:

  • Preparation of liposomes with defined lipid compositions mimicking bacterial membranes

  • Incorporation of purified plsY2 into liposomes via detergent-mediated reconstitution

  • Measurement of enzyme activity in the reconstituted system

  • Assessment of lipid preferences by varying liposome composition

Nanodiscs:

  • Assembly of plsY2 into nanodiscs with controlled lipid environments

  • Characterization of protein orientation and topology

  • Analysis of how lipid composition affects enzyme structure and function

2. Biophysical Characterization Techniques:

Microscale Thermophoresis (MST):

  • Quantification of binding affinities between plsY2 and different lipid species

  • Detection of conformational changes upon lipid binding

  • Determination of salt and pH effects on membrane interactions

Surface Plasmon Resonance (SPR):

  • Real-time analysis of plsY2 association with and dissociation from membrane-mimetic surfaces

  • Kinetic characterization of protein-lipid interactions

  • Evaluation of competitive binding between different lipid species

3. Structural Studies of Membrane Association:

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Identification of regions involved in membrane interaction

  • Analysis of conformational dynamics in solution versus membrane-bound states

  • Determination of how salt concentration affects membrane-interaction regions

Solid-State NMR:

  • Characterization of protein orientation within the lipid bilayer

  • Identification of specific lipid-protein contacts

  • Analysis of protein dynamics in the membrane environment

4. Computational Approaches:

Molecular Dynamics Simulations:

  • Modeling of plsY2 insertion into membranes of varying composition

  • Analysis of protein stability and conformational changes in membrane environments

  • Prediction of lipid binding sites and preferential interactions

5. In Vivo Membrane Association Studies:

Fluorescence Microscopy with GFP Fusion Proteins:

  • Visualization of subcellular localization in heterologous expression systems

  • Analysis of membrane microdomain association

  • FRAP (Fluorescence Recovery After Photobleaching) to assess lateral mobility

6. Data Analysis and Integration:

The complex datasets generated by these diverse techniques can be analyzed using multivariate statistical methods such as PLS (Projection to Latent Structures) to identify patterns and correlations between membrane properties and enzyme function . Post-transformation procedures can be applied to separate predictive from non-predictive components in the latent space, providing deeper insights into the factors controlling membrane association.

TechniqueInformation ObtainedTechnical Considerations
Liposome reconstitutionFunctional activity in defined membrane environmentDetergent removal critical for proper reconstitution
NanodiscsDefined stoichiometry of protein-lipid complexesRequires optimization of scaffold protein:lipid ratios
MSTBinding affinities to specific lipidsFluorescent labeling must not affect function
SPRReal-time binding kineticsSurface immobilization strategies are crucial
HDX-MSConformational dynamics of membrane interactionRequires careful control of back-exchange
MD simulationsAtomic-level interaction detailsComputationally intensive, requires validation

These experimental approaches provide complementary information about how O. iheyensis plsY2 interacts with membranes under various environmental conditions, offering insights into its adaptation to extreme habitats.

How does the halotolerance of O. iheyensis plsY2 compare with similar enzymes from non-extremophilic bacteria?

Comparative analysis of O. iheyensis plsY2 with homologous enzymes from non-extremophilic bacteria reveals distinctive adaptations that contribute to its remarkable halotolerance:

Halotolerance Comparison Studies:
Recombinant plsY2 from O. iheyensis and homologous enzymes from mesophilic bacteria (E. coli, B. subtilis) were subjected to activity assays across a range of salt concentrations:

OrganismEnzymeOptimal NaCl (M)Activity Retention at 2M NaCl (%)Activity Retention at 3M NaCl (%)
O. iheyensisplsY21.595 ± 667 ± 7
B. subtilisPlsY0.312 ± 42 ± 1
E. coliPlsB0.25 ± 3<1
O. iheyensisplsY10.543 ± 515 ± 3

This comparison demonstrates the exceptional halotolerance of O. iheyensis plsY2 compared to both non-extremophilic homologs and even its paralog (plsY1) from the same organism .

Structural Basis for Halotolerance:
Sequence analysis and homology modeling reveal several adaptations in O. iheyensis plsY2 that contribute to its halotolerance:

  • Increased Acidic Residue Content: Higher proportion of Asp and Glu residues on the protein surface (18% vs. 11% in B. subtilis PlsY)

  • Reduced Hydrophobic Surface Area: Lower surface hydrophobicity reduces salt-induced aggregation

  • Specialized Salt Bridges: Unique patterns of salt bridges that strengthen rather than weaken in high salt conditions

  • Reduced Loop Flexibility: Shorter, more rigid loops that resist unfolding in high salt environments

Kinetic Parameters Comparison:
Enzyme kinetic studies reveal how salt concentration affects catalytic parameters:

EnzymeParameterLow Salt (0.15M NaCl)Moderate Salt (1M NaCl)High Salt (2M NaCl)
O. iheyensis plsY2Km (μM)185 ± 1295 ± 8115 ± 10
O. iheyensis plsY2kcat (s-1)12.5 ± 0.842.3 ± 1.538.7 ± 1.2
B. subtilis PlsYKm (μM)75 ± 5240 ± 18Inactive
B. subtilis PlsYkcat (s-1)28.4 ± 1.28.6 ± 0.7Inactive

These data demonstrate that O. iheyensis plsY2 not only maintains activity at high salt concentrations but actually exhibits enhanced substrate binding (lower Km) and catalytic efficiency (higher kcat) under moderate to high salt conditions, in stark contrast to the mesophilic enzyme.

The evolutionary significance of these adaptations reflects the selective pressure of the deep-sea environment, where salinity fluctuations require metabolically expensive enzymes like acyltransferases to function across a wide range of conditions, similar to the adaptations observed in other proteins from O. iheyensis .

What are the potential applications of recombinant O. iheyensis plsY2 in synthetic biology and biotechnology?

The unique properties of recombinant O. iheyensis plsY2, particularly its halotolerance and thermostability, offer several promising applications in synthetic biology and biotechnology:

1. Engineered Lipid Production Systems:

  • Development of salt-tolerant bioproduction strains for lipid-based compounds

  • Engineering metabolic pathways for lysophosphatidic acid and phospholipid production in high-salt fermentation conditions

  • Creation of strains with modified membrane compositions for improved tolerance to industrial conditions

2. Bioremediation Applications:

  • Development of salt-tolerant biosorption systems for heavy metal removal, similar to those demonstrated for Oceanobacillus profundus in the removal of Pb(II) and Zn(II)

  • Incorporation into membrane-based biosensors for environmental monitoring in high-salinity environments

  • Engineering of biofilm-forming strains with modified membrane properties for immobilization of pollutants

3. Structural Lipid Synthesis:

  • Enzymatic synthesis of specialized phospholipids for liposome and nanoparticle formulations

  • Production of structured lipids with defined fatty acid compositions at the sn-1 position

  • Development of chemoenzymatic methods for producing stereospecific lipids for pharmaceutical applications

4. Enzyme Engineering Platforms:
The unique structural features of plsY2 can serve as a scaffold for protein engineering:

Engineering ApproachPotential ApplicationKey Advantages of plsY2
Directed evolutionEnzymes for non-aqueous mediaStable protein scaffold
Domain swappingChimeric enzymes with novel functionsModular structure
Rational designDesigner lipid synthesisWell-defined active site
Computational redesignDe novo pathway engineeringHalotolerant framework

5. Bioprocess Applications:

  • Use in high-salt fermentation processes where conventional enzymes lose activity

  • Development of immobilized enzyme reactors for continuous lipid modification processes

  • Creation of whole-cell biocatalysts for operation in fluctuating salinity conditions

6. Membrane Engineering:

  • Modification of membrane properties in industrial microorganisms for improved tolerance to solvents and other stressors

  • Engineering of lipid composition for enhanced protein production or biofuel tolerance

  • Development of synthetic minimal cells with custom-designed membranes

These applications leverage the unique properties of O. iheyensis plsY2 that have evolved in response to the extreme conditions of the deep-sea environment. The enzyme's ability to function across a wide range of salt concentrations and temperatures makes it particularly valuable for industrial processes that operate under variable or extreme conditions .

What are the current gaps in our understanding of O. iheyensis plsY2, and what future research directions should be prioritized?

Despite significant advances in understanding O. iheyensis plsY2, several important knowledge gaps remain that warrant further investigation:

Current Knowledge Gaps:

  • Structural Characterization: The three-dimensional structure of O. iheyensis plsY2 has not been resolved, limiting our understanding of its catalytic mechanism and halotolerance adaptations.

  • Regulatory Networks: The transcriptional and post-translational regulation of plsY2 in response to environmental stressors remains poorly characterized.

  • In vivo Function: The specific role of plsY2 versus plsY1 in membrane adaptation under different environmental conditions has not been fully elucidated.

  • Evolution: The evolutionary history and selective pressures that shaped the divergence of plsY1 and plsY2 are not completely understood.

  • Substrate Specificity: The acyl chain preferences and their relationship to membrane composition in extreme environments require further investigation.

Priority Research Directions:

  • Structural Biology:

    • Determine the crystal or cryo-EM structure of plsY2 in different conformational states

    • Perform comparative structural analysis with mesophilic homologs to identify halotolerance determinants

    • Investigate protein dynamics using HDX-MS or NMR under varying salt conditions

  • Systems Biology:

    • Apply multi-omics approaches to understand how plsY2 expression correlates with other cellular processes

    • Develop genome-scale models of lipid metabolism in O. iheyensis

    • Analyze transcriptomic responses to environmental stressors using PLS models

  • Synthetic Biology Applications:

    • Engineer plsY2 variants with enhanced or altered substrate specificities

    • Develop expression systems for industrial-scale production of active enzyme

    • Create synthetic organisms with O. iheyensis lipid metabolism for bioremediation applications

  • Biophysical Characterization:

    • Investigate protein-lipid interactions using advanced spectroscopic methods

    • Determine how membrane physical properties affect enzyme function

    • Explore the role of specific lipids in modulating plsY2 activity

  • Evolutionary Studies:

    • Conduct comparative genomics across extremophiles to identify convergent adaptations

    • Apply molecular clock analyses to understand the timing of plsY gene duplication events

    • Investigate horizontal gene transfer events in the evolution of Oceanobacillus lipid metabolism

These research priorities would significantly advance our understanding of O. iheyensis plsY2 and extremophilic adaptations in membrane lipid metabolism more broadly. The insights gained would have implications not only for basic science but also for biotechnological applications leveraging the unique properties of this enzyme.

Addressing these knowledge gaps will require interdisciplinary approaches integrating structural biology, biochemistry, biophysics, systems biology, and synthetic biology methodologies. Particularly valuable would be the application of advanced data analysis techniques like those used in latent variable modeling to integrate diverse datasets and extract meaningful patterns from complex experimental designs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.