Recombinant Oceanobacillus iheyensis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
mscL; OB1021; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Target Names
mscL
Target Protein Sequence
MWKEFKEFAFKGNIIDLAVAVVIGGAFGAIVTSFVENIITPLMGVIVGGVDFTTLKVTVG EAEILYGNFIQSFVDFIIIAFSIFLAIKFLVKFKRQKEEEEVEAVVEELSKQEELLTEIR DLLKEQSNKN
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane stretch. It may play a role in regulating cellular osmotic pressure.

Database Links

KEGG: oih:OB1021

STRING: 221109.OB1021

Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the structural features of Oceanobacillus iheyensis MscL and how do they compare to other bacterial MscL proteins?

The Large-conductance mechanosensitive channel (MscL) from Oceanobacillus iheyensis shares core structural characteristics with MscL proteins from other bacterial species. Typically, MscL forms a homopentamer with each subunit containing two transmembrane regions . The channel gates via the bilayer mechanism, which is triggered by hydrophobic mismatch and changes in membrane curvature and/or transbilayer pressure profile .

Oceanobacillus iheyensis, being an alkaliphilic and extremely halotolerant Bacillus-related species isolated from deep-sea sediment, likely exhibits adaptive modifications in its MscL protein to function optimally in high pH and saline environments . While the precise structural differences remain to be fully characterized, the adaptation of O. iheyensis to extreme environments makes its MscL particularly interesting for comparative structural studies with MscL proteins from neutrophilic bacteria.

What methods are most effective for recombinant expression of O. iheyensis MscL?

For recombinant expression of O. iheyensis MscL, several methodological approaches have proven effective:

Expression System Selection:
A gene SOEing (gene splicing by overlap extension) PCR-based method can be employed to clone the O. iheyensis mscL gene . For bacterial expression, E. coli systems using vectors such as pBAD24 with an arabinose-inducible promoter or pDR67 have shown success with similar membrane proteins .

Expression Protocol:

  • Design primers based on the O. iheyensis genome sequence, incorporating appropriate restriction sites (e.g., BamHI and SphI or NcoI and PstI)

  • Amplify the target gene using high-fidelity PCR

  • Clone the amplified fragment into the selected expression vector

  • Transform expression host cells and confirm the presence of the insert using conventional techniques

  • Induce expression under optimized conditions (temperature, inducer concentration, duration)

  • Harvest cells by centrifugation and extract the membrane fraction

Optimization Considerations:

  • Lower induction temperatures (25-30°C) often improve the folding of membrane proteins

  • Including osmolytes in the growth medium may enhance functional expression

  • Using E. coli strains specialized for membrane protein expression (e.g., C41(DE3), C43(DE3)) can increase yields

How can researchers verify the functionality of recombinant O. iheyensis MscL?

Verifying the functionality of recombinant O. iheyensis MscL requires multiple complementary approaches:

Patch-Clamp Electrophysiology:
Reconstitute the purified MscL into artificial lipid bilayers or liposomes and measure channel conductance and gating characteristics in response to membrane tension . The large conductance of MscL (approximately 3.6 nS) makes it distinguishable from other channels .

Osmotic Shock Survival Assay:
Transform MscL-deficient bacterial strains with the recombinant O. iheyensis MscL and subject them to hypoosmotic shock. Functional MscL will protect cells from lysis, providing a survival advantage that can be quantified by comparing colony-forming units before and after shock .

Fluorescent Dye Efflux Assay:
Load bacterial cells or liposomes containing recombinant MscL with self-quenching fluorescent dyes. Upon channel activation by osmotic downshift or membrane tension, dye release can be measured as an increase in fluorescence intensity.

What are the optimal conditions for maintaining O. iheyensis MscL activity during purification?

Maintaining O. iheyensis MscL activity during purification requires careful consideration of the protein's native environment. Since O. iheyensis is alkaliphilic and halotolerant, the following conditions are recommended:

Buffer Composition:

  • pH: 8.5-10.0 (reflecting the alkaliphilic nature of O. iheyensis)

  • Salt concentration: 200-500 mM NaCl or KCl (accommodating halotolerance)

  • Detergent: n-Dodecyl β-D-maltoside (DDM) or n-Octyl-β-D-glucopyranoside (OG) at concentrations slightly above CMC

  • Glycerol: 10-15% to stabilize the protein

  • EDTA: 1-5 mM to chelate divalent cations that might interfere with protein stability

Purification Protocol:

  • Solubilize membrane fractions using selected detergent

  • Perform affinity chromatography (if a tag was included in the recombinant construct)

  • Conduct size-exclusion chromatography to obtain homogeneous protein

  • Verify protein quality by SDS-PAGE and Western blotting

  • Store purified protein at -80°C with cryoprotectants or maintain at 4°C for short-term use

Quality Control Metrics:
Monitor protein homogeneity and activity throughout purification using:

  • Size-exclusion chromatography profiles (sharp, symmetric peaks indicate homogeneous preparation)

  • Circular dichroism to verify secondary structure

  • Patch-clamp analysis of samples at different purification stages to track activity retention

How should researchers design experiments to study the ion selectivity of O. iheyensis MscL?

Studying ion selectivity of O. iheyensis MscL requires carefully designed experiments that can distinguish between different ions while maintaining channel functionality:

Electrophysiological Approaches:

  • Patch-Clamp Analysis with Ion Substitution:

    • Prepare symmetrical and asymmetrical solutions varying in ion composition

    • Measure reversal potentials under different ionic gradients

    • Calculate permeability ratios using the Goldman-Hodgkin-Katz equation

  • Planar Lipid Bilayer Recordings:

    • Reconstitute purified MscL in defined lipid compositions

    • Systematically vary ion concentrations on either side of the membrane

    • Apply tension via suction or osmotic gradient to activate the channel

    • Record single-channel conductance for different ions

Cellular Approaches:

  • Swimming Speed Assays in Bacteria:
    Similar to the approach used for flagellar motors , express O. iheyensis MscL in a suitable bacterial host and measure swimming speed in buffers containing different ions (Na+, K+, Rb+) at various concentrations.

  • Ion Uptake Measurements:

    • Express O. iheyensis MscL in ion transport-deficient bacterial strains

    • Measure intracellular accumulation of radioactive or fluorescent ion indicators

    • Compare uptake rates in the presence and absence of channel activators

Analytical Approaches:
Track ion movement using:

  • Radioactive ion tracers

  • Ion-selective electrodes

  • Fluorescent ion indicators

Data Analysis Framework:
Create a comprehensive comparison table of ion conductance properties:

IonConductance (nS)Permeability Ratio (Px/PK)Concentration for Half-maximal Response (mM)Gating Tension with Ion (mN/m)
K+[Measured value]1.0 (reference)[Measured value][Measured value]
Na+[Measured value][Calculated value][Measured value][Measured value]
Rb+[Measured value][Calculated value][Measured value][Measured value]
Ca2+[Measured value][Calculated value][Measured value][Measured value]
Mg2+[Measured value][Calculated value][Measured value][Measured value]

What techniques are available for studying MscL gating kinetics in O. iheyensis?

Studying MscL gating kinetics requires methods that can capture rapid conformational changes in response to membrane tension:

High-Resolution Techniques:

  • Single-Channel Patch-Clamp Recording:

    • Record at high sampling rates (>10 kHz) to capture fast gating events

    • Apply precisely controlled membrane tension using calibrated suction

    • Analyze dwell times in open and closed states

    • Construct kinetic models using QuB, HJCfit, or similar software

  • High-Speed Atomic Force Microscopy (HS-AFM):

    • Visualize conformational changes in real-time

    • Correlate structural changes with applied membrane tension

    • Extract kinetic parameters from time-resolved structural data

  • Fluorescence Resonance Energy Transfer (FRET):

    • Introduce fluorescent labels at strategic positions in MscL

    • Monitor distance changes between labels during gating

    • Perform stopped-flow measurements to capture rapid kinetics

Computational Approaches:

  • Molecular Dynamics Simulations:

    • Model O. iheyensis MscL based on known MscL structures

    • Simulate channel behavior under various membrane tensions

    • Extract theoretical kinetic parameters for comparison with experimental data

  • Markov State Modeling:

    • Integrate experimental data into mathematical models of channel states

    • Predict transition probabilities between conformational states

    • Generate testable hypotheses about gating mechanisms

Data Analysis and Representation:
Present kinetic data as:

  • Dwell-time histograms

  • State transition diagrams

  • Energy landscapes

  • Rate constants for key transitions

How does the function of O. iheyensis MscL compare to MscL channels from other extremophiles?

O. iheyensis MscL represents an interesting case study in how mechanosensitive channels adapt to extreme environments. Comparative analysis reveals important functional adaptations:

Comparative Functional Properties:

SpeciesEnvironmentGating ThresholdIon SelectivitypH OptimumTemperature Range
O. iheyensisAlkaline, high salt[Value] mN/m[Preference pattern]pH 8.5-10.5[Range] °C
E. coli (mesophile)Neutral, moderate salt~10-12 mN/mSlight cation preferencepH 6-820-42°C
Thermophilic speciesHigh temperature[Value] mN/m[Preference pattern][Range][Range] °C
Acidophilic speciesAcidic[Value] mN/m[Preference pattern]pH 2-5[Range] °C

Structural Adaptations:
O. iheyensis, being alkaliphilic and extremely halotolerant, likely exhibits adaptations in its MscL that enable function in high pH and saline environments . These may include:

  • Modified surface charge distribution to accommodate alkaline conditions

  • Altered hydrophobic gate properties to maintain appropriate tension sensitivity in high salt

  • Specific amino acid substitutions in the channel pore that affect ion conductance

  • Adapted tension-sensing interfaces between subunits

What is known about the genomic context of the mscL gene in O. iheyensis and how might it influence expression?

The genomic context of the mscL gene in O. iheyensis provides important clues about its regulation and expression:

Genomic Organization:
Analysis of the O. iheyensis genome (3.6 Mb) reveals that genes associated with adaptation to alkaline and saline environments, including those involved in osmotic pressure regulation, form part of the organism's stress response network. The specific genomic neighborhood of the mscL gene may include:

  • Osmoregulatory genes

  • pH homeostasis-related genes

  • Membrane composition regulatory elements

  • Transcription factors responsive to osmotic stress

Regulatory Elements:
Based on knowledge of other bacterial mechanosensitive channels, the expression of O. iheyensis mscL is likely controlled by:

  • Promoter elements responsive to osmotic upshift/downshift

  • Stationary phase-specific regulatory factors

  • pH-responsive transcription factors unique to alkaliphiles

  • Possible involvement of small regulatory RNAs

Expression Patterns:
Similar to other MscL proteins, O. iheyensis MscL is likely upregulated during:

  • Stationary phase growth

  • Exposure to osmotic shock

  • Transitions to more alkaline environments

Experimental Approaches to Study Expression:

  • Quantitative PCR to measure mscL transcript levels under various conditions

  • Reporter gene fusions to visualize expression patterns

  • Chromatin immunoprecipitation to identify regulatory factors

  • RNA-seq to map transcriptional networks associated with mscL expression

How can researchers effectively engineer mutations in O. iheyensis MscL to study structure-function relationships?

Engineering mutations in O. iheyensis MscL requires systematic approaches to correlate structural changes with functional outcomes:

Mutation Strategy Development:

  • Evolutionary Conservation Analysis:

    • Align MscL sequences from diverse bacteria to identify conserved and variable regions

    • Focus on residues unique to alkaliphilic/halotolerant species

    • Target the N-h-h-D consensus motif found in many channel families

  • Structure-Guided Mutation Design:

    • Target key functional domains:

      • Transmembrane regions that form the pore

      • Cytoplasmic domains involved in gating

      • Interfaces between subunits

      • Lipid-interacting surfaces

  • Systematic Mutation Approaches:

    • Alanine scanning of selected regions

    • Conservative vs. non-conservative substitutions

    • Introduction of reporter groups (cysteine residues for fluorescent labeling)

    • Chimeric constructs with MscL from other species

Mutation Methods:
The gene SOEing method can be effectively used to introduce mutations, as demonstrated with motS gene mutations :

  • Synthesize pairs of mutant primers with mismatches at the mutation sites

  • Amplify the gene using these primers

  • Clone the mutated gene into an appropriate expression vector

  • Confirm mutations by DNA sequencing

Functional Analysis of Mutants:

  • Electrophysiological Characterization:

    • Measure changes in conductance, gating threshold, and kinetics

    • Determine altered ion selectivity profiles

  • In vivo Functional Assays:

    • Osmotic survival tests in MscL-deficient bacterial strains

    • Growth phenotypes under various osmotic conditions

  • Structural Analysis:

    • Assess protein folding and stability using circular dichroism

    • Determine structural changes using X-ray crystallography or cryo-EM

Data Representation Framework:
Present mutation effects in a comprehensive manner:

MutationLocationConservationGating Threshold ChangeConductance ChangeIon Selectivity ChangeStructural EffectPhenotypic Effect
M33LTM1Moderate+20%No changeIncreased Na+ selectivityAltered helix packingEnhanced survival
[Example][Domain][Level][% change][% change][Pattern][Observation][Observation]

What are the most reliable methods for crystallizing recombinant O. iheyensis MscL for structural studies?

Crystallizing membrane proteins like MscL presents significant challenges. For O. iheyensis MscL, consider these specialized approaches:

Pre-crystallization Considerations:

  • Protein Engineering:

    • Remove flexible regions that may impede crystallization

    • Consider fusion partners that facilitate crystal contacts (e.g., T4 lysozyme)

    • Introduce surface mutations that enhance crystal formation while preserving function

  • Detergent Screening:

    • Test multiple detergents (DDM, OG, LDAO, etc.)

    • Evaluate detergent stability using dynamic light scattering

    • Consider novel amphipols or nanodiscs for stabilization

Crystallization Methods:

  • Lipidic Cubic Phase (LCP):

    • Particularly suitable for membrane proteins

    • Provides native-like lipid environment

    • Requires specialized equipment and expertise

  • Vapor Diffusion:

    • Detergent-solubilized protein in hanging or sitting drops

    • Screen wide range of precipitants, pH values, and additives

    • Optimize drop size and protein-to-reservoir ratios

  • Bicelle Method:

    • Mixture of long- and short-chain lipids

    • Intermediate between detergent and lipid environments

    • Can promote crystal formation for challenging membrane proteins

Post-crystallization Treatments:
For RNA crystal improvement techniques that may be adapted for membrane proteins :

  • Dehydration protocols:

    • Gradually increase precipitant concentration

    • Control humidity using specialized chambers

  • Ion replacement:

    • Soak crystals in solutions with modified ion compositions

    • Can dramatically improve diffraction quality

Crystal Quality Assessment:

  • Test diffraction at home source before synchrotron trips

  • Evaluate mosaicity, resolution limits, and anisotropy

  • Consider micro-focus beamlines for small crystals

Complementary Structural Methods:
If crystallization proves challenging:

  • Cryo-electron microscopy (single-particle analysis)

  • Solid-state NMR spectroscopy

  • Small-angle X-ray scattering (SAXS) for low-resolution envelopes

What methodologies are effective for studying the interaction between O. iheyensis MscL and potential pharmaceutical compounds?

Investigating interactions between O. iheyensis MscL and pharmaceutical compounds requires multifaceted approaches:

High-throughput Screening Methods:

  • Liposome-based Fluorescence Assays:

    • Reconstitute MscL in liposomes containing self-quenching fluorescent dyes

    • Screen compounds for those that trigger dye release (channel activators)

    • Identify compounds that block tension-induced dye release (channel inhibitors)

  • Patch-Clamp Electrophysiology:

    • Direct measurement of compound effects on channel gating and conductance

    • Determine dose-response relationships

    • Characterize mechanism of action (competitive vs. allosteric)

  • Thermal Shift Assays:

    • Measure changes in protein thermal stability upon compound binding

    • Suitable for initial screening of potential binding partners

Binding Site Identification:

  • Site-Directed Mutagenesis:

    • Systematically mutate potential binding sites

    • Assess changes in compound efficacy to map interaction surfaces

  • Photoaffinity Labeling:

    • Modify compounds with photoactivatable groups

    • Identify binding sites through mass spectrometry after UV-induced crosslinking

  • Structural Studies:

    • Co-crystallization with compounds

    • Cryo-EM of MscL-compound complexes

    • NMR for detecting compound-induced conformational changes

In Silico Methods:

  • Molecular Docking:

    • Virtual screening of compound libraries

    • Binding energy calculations

    • Identification of potential binding pockets

  • Molecular Dynamics Simulations:

    • Investigate dynamic interactions between compounds and MscL

    • Predict effects on channel gating and lipid interactions

Biological Relevance Assessment:

  • Bacterial Growth Assays:

    • Determine effects of compounds on bacterial survival during osmotic shock

    • Assess synergy with existing antibiotics

  • Selectivity Profiling:

    • Test compounds against human mechanosensitive channels to assess specificity

    • Evaluate activity against MscL from different bacterial species

Pharmaceutical Development Framework:
For compounds showing promise as "new age antibiotics to combat multiple drug-resistant bacterial strains" :

CompoundBinding Affinity (Kd)Mode of ActionEC50/IC50Selectivity IndexEffect on Bacterial SurvivalStructure-Activity Relationship
[Example][Value] μMChannel activator[Value] μM[Value][% reduction][Key chemical groups]

What are effective strategies for troubleshooting expression problems with recombinant O. iheyensis MscL?

When encountering expression problems with recombinant O. iheyensis MscL, follow this systematic troubleshooting approach:

Problem Assessment and Diagnosis:

ProblemPossible CausesDiagnostic Tests
No expression detectedToxicity to host, poor transcription, rapid degradationWestern blot with anti-His/tag antibodies, RT-PCR for mRNA levels
Insoluble expressionImproper folding, inclusion body formationMicroscopy of cells, fractionation analysis
Inactive proteinImproper folding, missing cofactors, improper environmentFunctional assays, circular dichroism
Low yieldWeak promoter, codon bias, growth conditionsOptimize induction parameters, change host strain

Methodological Solutions:

  • Expression System Optimization:

    • Try different E. coli strains (BL21(DE3), C41(DE3), C43(DE3))

    • Test various promoters (T7, tac, araBAD)

    • Optimize codon usage for E. coli if necessary

    • Consider strain engineering to provide rare tRNAs

  • Growth and Induction Conditions:

    • Vary temperature (16°C, 25°C, 30°C, 37°C)

    • Test different inducer concentrations

    • Examine effect of induction time (2h, 4h, overnight)

    • Supplement media with osmolytes like betaine or sucrose

  • Protein Solubilization and Extraction:

    • Test multiple detergents and concentrations

    • Optimize lysis conditions (sonication, high pressure, enzymatic)

    • Try extracting from different growth phases

    • Add protease inhibitors to prevent degradation

  • Construct Modifications:

    • Change affinity tags or their position (N- vs C-terminal)

    • Create fusion proteins with solubility enhancers (MBP, SUMO)

    • Engineer out problematic sequences (protease sites, aggregation-prone regions)

Experimental Decision Tree:

  • Verify gene sequence is correct

  • Confirm mRNA is produced

  • Test for protein expression using different detection methods

  • If expressed but inactive, optimize extraction and folding conditions

  • If no expression, modify construct and expression system

How can researchers effectively design experiments to investigate the physiological role of MscL in O. iheyensis?

Investigating the physiological role of MscL in O. iheyensis requires approaches that connect molecular function to cellular adaptation:

Genetic Manipulation Strategies:

  • Gene Deletion/Knockdown:

    • Create MscL-deficient O. iheyensis strains

    • Use CRISPR-Cas9 or homologous recombination methods

    • Consider inducible systems if complete deletion is lethal

  • Complementation Studies:

    • Reintroduce wild-type or mutant MscL to knockout strains

    • Express MscL from different bacterial species in O. iheyensis MscL knockouts

    • Use controlled expression systems to titrate MscL levels

Physiological Response Assessment:

  • Osmotic Challenge Experiments:

    • Compare survival rates of wild-type and MscL-deficient strains during hypoosmotic shock

    • Measure release of cytoplasmic solutes during osmotic downshift

    • Monitor cell morphology changes during osmotic transitions

  • Growth Under Extreme Conditions:

    • Evaluate growth at varying pH levels (7-11)

    • Assess salt tolerance (0-25% NaCl)

    • Measure impact of combined stressors (high pH + high salt)

  • Cell Imaging Studies:

    • Visualize cell morphology changes during osmotic shock using time-lapse microscopy

    • Employ fluorescent membrane dyes to monitor membrane integrity

    • Use GFP-tagged MscL to track protein localization and abundance

Molecular Response Analysis:

  • Transcriptomics:

    • Compare gene expression profiles of wild-type and MscL-deficient strains

    • Identify compensatory mechanisms in MscL-deficient backgrounds

    • Map MscL-dependent stress response networks

  • Proteomics:

    • Quantify changes in membrane protein composition

    • Identify interaction partners of MscL using pull-down assays

    • Measure post-translational modifications of MscL under stress

  • Metabolomics:

    • Profile cytoplasmic osmolytes during adaptation

    • Measure ion compositions in adapted cells

    • Track energy metabolism during osmotic challenges

Experimental Design Framework:
When designing experiments, follow the PICOT format to ensure robust design :

  • Population: Clearly define the O. iheyensis strains to be used

  • Intervention: Specify the experimental manipulation (gene deletion, osmotic shock, etc.)

  • Comparison: Include appropriate controls (wild-type, complemented strains)

  • Outcome: Define measurable endpoints (survival rates, gene expression changes)

  • Time: Establish the timeline for measurements and observations

What analytical techniques can resolve conflicting data in O. iheyensis MscL research?

When faced with conflicting data in O. iheyensis MscL research, employ these analytical techniques and approaches:

Methodology Validation:

  • Cross-Validation with Multiple Techniques:

    • Verify key findings using orthogonal methods

    • For example, confirm patch-clamp findings with fluorescence-based assays

    • Compare in vitro results with in vivo observations

  • Control Experiments:

    • Include positive and negative controls in all experiments

    • Perform calibration checks on equipment

    • Use well-characterized standards to validate assays

  • Blinded Analysis:

    • Have data analyzed by researchers unaware of experimental conditions

    • Implement automated analysis pipelines to reduce bias

    • Use standard operating procedures for consistent data collection

Data Integration Approaches:

Resolution Strategies for Specific Conflicts:

  • Functional Contradictions:

    • Verify protein folding and activity after purification

    • Check for experimental artifacts related to tags or fusion partners

    • Examine influence of lipid composition on channel behavior

  • Structural Discrepancies:

    • Compare results from different structural biology techniques

    • Assess the impact of detergents or membrane mimetics

    • Consider protein dynamics not captured in static structures

  • Physiological Role Conflicts:

    • Examine strain differences and growth conditions

    • Consider redundancy with other mechanosensitive channels

    • Investigate environmental factors specific to O. iheyensis habitat

Collaborative Resolution Framework:
For resolving significant conflicts in the field:

  • Organize focused workshops or collaborative studies

  • Standardize key protocols across laboratories

  • Establish repositories of validated strains and constructs

  • Develop consensus criteria for evaluating evidence quality

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.