Recombinant Oceanobacillus iheyensis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction

Lipoprotein signal peptidase (LspA) is an aspartyl protease responsible for cleaving the transmembrane helix signal peptide of lipoproteins, a crucial step in the lipoprotein-processing pathway . This pathway is essential in Gram-negative bacteria and important for virulence in Gram-positive bacteria, with no mammalian homologs, making it an attractive target for developing new antibiotic therapeutics . Oceanobacillus iheyensis is an extremely halotolerant and alkaliphilic bacterium isolated from deep-sea sediment .

Oceanobacillus iheyensis

Oceanobacillus iheyensis is a Gram-positive, strictly aerobic, rod-shaped, spore-forming bacterium that exhibits motility via peritrichous flagella . It thrives in high-salinity and alkaline conditions, with optimal growth at 3% NaCl concentration at both pH 7.5 and 9.5 . Originally isolated from a depth of 1050 m on the Iheya Ridge, this bacterium's unique characteristics have garnered interest in understanding microbial life in extreme environments .

Function of LspA

LspA is a key enzyme in the lipoprotein-processing pathway . Lipoproteins, characterized by an N-terminal lipid moiety that anchors them to the membrane, perform various functions, including signal transduction, stress sensing, virulence, cell division, nutrient uptake, adhesion, and triggering host innate immune responses . LspA cleaves the transmembrane helix signal peptide of lipoproteins following lipidation by phosphatidylglycerol-prolipoprotein diacylglyceryl transferase (Lgt) . Incorrectly processed lipoproteins can compromise bacterial functions .

LspA as an Antibiotic Target

The extensive conservation of LspA's catalytic dyad residues and surrounding residues indicates that resistance mutations within the active site would likely interfere with substrate binding and cleavage, making LspA a potential target to combat antibiotic resistance .

Recombinant LspA

Recombinant LspA is produced using genetic engineering techniques to express the lspA gene in a host organism like E. coli . The recombinant protein can be used in various applications, including structural studies, drug discovery, and enzyme characterization .

Applications of Recombinant Oceanobacillus iheyensis LspA

ApplicationDescription
Antibiotic DevelopmentLspA is a target for new antibacterial drugs because it is essential for bacterial survival and has no human equivalent .
Structural Biology StudiesRecombinant LspA allows researchers to determine the protein's structure and understand its mechanism of action .
Enzyme Activity AssaysRecombinant LspA is used to measure its enzymatic activity and study the effects of inhibitors .
ELISARecombinant LspA can be used as an antigen in ELISA assays for detecting anti-LspA antibodies .
Conformational Dynamics StudiesMolecular dynamics simulations and electron paramagnetic resonance (EPR) studies use recombinant LspA to understand the conformational changes associated with substrate binding and signal peptide cleavage . The apo protein fluctuates between open and closed conformations, affecting substrate and antibiotic binding. Globomycin stabilizes an intermediate conformation, inhibiting signal peptide cleavage and substrate binding .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
lspA; OB1485; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Target Names
lspA
Target Protein Sequence
MIMYYLIAIALVIIDQLTKWLVVSRMELGESISVIDNFFYITSHRNTGAAWGILEGQMLL FYIITTIVIIGIIYFLHTHAKGDKLLSVALVVILGGAIGNFIDRIFRQEVVDFANFYIFD YNFPIFNVADSSLTIGVILFLIATILEEKRQKGKSKS
Uniprot No.

Target Background

Function
This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.
Database Links

KEGG: oih:OB1485

STRING: 221109.OB1485

Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Lipoprotein signal peptidase (lspA) and what is its role in bacterial physiology?

    Lipoprotein signal peptidase (lspA), also known as Signal peptidase II (SPase II), is an essential enzyme in the bacterial lipoprotein processing pathway. This membrane-bound enzyme cleaves the signal peptide from prolipoproteins after lipid modification, allowing mature lipoproteins to be properly anchored to the bacterial membrane.

    Computer-assisted analyses indicate that Bacillus subtilis contains approximately 300 genes for exported proteins with an amino-terminal signal peptide, of which about 114 encode lipoproteins retained in the cytoplasmic membrane . These lipoproteins serve critical functions including:

    • Maintaining membrane integrity

    • Regulating cellular homeostasis, particularly at temperature extremes

    • Facilitating nutrient transport and sensing

    • Contributing to cell wall synthesis and remodeling

    Research has demonstrated that lipoprotein processing is important for cell viability at low and high temperatures, suggesting lipoproteins are essential for growth under these conditions . Interestingly, while processing by SPase II is not strictly required for lipoprotein function in B. subtilis, it significantly impacts their optimal functionality.

  • How does Oceanobacillus iheyensis adapt to extreme environments, and what role might lspA play in this adaptation?

    Oceanobacillus iheyensis HTE831 is an alkaliphilic and extremely halotolerant Bacillus-related species isolated from deep-sea sediment . Its 3.6 Mb genome encodes numerous proteins associated with regulating intracellular osmotic pressure and pH homeostasis, which are crucial for survival in highly alkaline and saline environments .

    The lspA enzyme likely contributes to environmental adaptation through:

    1. Processing specialized lipoproteins involved in osmotic regulation

    2. Ensuring proper membrane protein localization in high pH environments

    3. Contributing to cell wall integrity under extreme salinity and pH

    Studies of alkaliphilic Bacillus species show that surface layer proteins and peptidoglycan synthesis play important roles in alkaline adaptation . Since lipoproteins processed by lspA often function in cell wall biosynthesis and maintenance, proper functioning of lspA is likely critical for O. iheyensis to maintain cellular integrity in its extreme native environment.

    Comparative analysis with other Bacillus species suggests the O. iheyensis lspA has evolved specific structural adaptations to function optimally under alkaline conditions, potentially including modified active site architecture and altered surface charge distribution.

  • What experimental approaches can be used to study the function of O. iheyensis lspA in vivo?

    Several complementary approaches can be employed to investigate lspA function in biological systems:

    Genetic Complementation Studies:

    1. Generate an lspA knockout strain in a model organism (e.g., B. subtilis)

    2. Transform with a plasmid expressing O. iheyensis lspA

    3. Assess restoration of growth phenotypes, particularly at temperature extremes

    4. Monitor processing of endogenous lipoproteins via Western blotting

    Fluorescent Reporter Systems:

    1. Create fusion constructs of fluorescent proteins with lipoprotein signal sequences

    2. Express these constructs in cells with/without functional lspA

    3. Track localization and processing using fluorescence microscopy

    4. Quantify processing efficiency under various conditions

    Phenotypic Analysis:
    Research with B. subtilis has shown that cells lacking SPase II exhibit impaired viability at temperature extremes . Similar experiments with O. iheyensis lspA could include:

    1. Growth rate measurements across pH and temperature ranges

    2. Assessment of membrane integrity using dye exclusion assays

    3. Analysis of cellular morphology via electron microscopy

    4. Measurement of specific lipoprotein-dependent activities

    Unexpectedly, research has shown that certain developmental processes requiring lipoproteins (competence, sporulation, germination) were not affected in the absence of SPase II in B. subtilis , suggesting complex relationships between lipoprotein processing and function that warrant further investigation in O. iheyensis.

Advanced Research Questions

  • What are the optimal expression and purification methods for recombinant O. iheyensis lspA?

    Expressing and purifying membrane proteins like lspA presents unique challenges. Based on successful approaches with similar membrane proteins, the following optimized protocol is recommended:

    Expression System Selection:

    SystemAdvantagesDisadvantagesRecommendation
    E. coli BL21(DE3)High yields, easy handlingPotential inclusion bodiesUse with C41/C43 strains specialized for membrane proteins
    B. subtilisNative-like environmentLower yieldsConsider for functional studies
    Cell-free synthesisAvoids toxicity issuesExpensive, limited scaleUse for difficult constructs

    Expression Protocol:

    1. Clone lspA gene into pET-based vector with C-terminal His6-tag

    2. Transform into E. coli C41(DE3)

    3. Culture in TB medium at 37°C to OD600 of 0.6

    4. Induce with 0.2 mM IPTG

    5. Shift temperature to 20°C and continue expression for 18 hours

    6. Harvest cells by centrifugation at 5,000g for 15 minutes

    Purification Strategy:

    1. Resuspend cell pellet in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    2. Lyse cells using sonication or French press

    3. Isolate membranes by ultracentrifugation (100,000g, 1 hour)

    4. Solubilize membrane proteins with 1% n-dodecyl-β-D-maltopyranoside (DDM)

    5. Purify using Ni-NTA affinity chromatography

    6. Apply size exclusion chromatography for final purity

    7. Store in 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM, 50% glycerol

    For long-term storage, aliquot the purified protein and store at -20°C or -80°C. Repeated freezing and thawing should be avoided to maintain activity .

  • How can researchers assess the enzymatic activity of purified O. iheyensis lspA?

    Multiple complementary assays can be employed to characterize lspA activity:

    Fluorogenic Substrate Assay:

    1. Design peptide substrates containing the lipobox consensus sequence

    2. Incorporate fluorophore-quencher pairs that separate upon cleavage

    3. Measure fluorescence increase in real-time as substrate is cleaved

    4. Calculate kinetic parameters (Km, kcat, Vmax)

    HPLC-MS Analysis:

    1. Incubate lspA with synthetic prolipoprotein substrates

    2. Stop reactions at defined timepoints with acid or heat denaturation

    3. Analyze reaction products using LC-MS/MS

    4. Quantify substrate and product peaks to determine reaction rates

    Activity Parameters Analysis:

    ParameterExpected RangeNotes
    pH optimum8.5-10.5Reflects alkaliphilic nature of O. iheyensis
    Temperature optimum30-45°CMay vary based on buffer conditions
    Salt tolerance0-2M NaClReflects halotolerant properties
    Km10-100 μMFor synthetic peptide substrates
    kcat1-10 s-1May vary with substrate structure

    Studies with B. subtilis have shown that in the absence of SPase II, cells accumulate lipid-modified precursor and mature-like forms of lipoproteins like PrsA (a folding catalyst for secreted proteins), with reduced functional activity . Similar approaches could be used to assess O. iheyensis lspA activity by monitoring the processing state of specific lipoproteins.

  • How does the alkaliphilic nature of O. iheyensis affect the structure-function relationship of its lspA?

    O. iheyensis thrives in highly alkaline environments, and its lspA likely possesses specific adaptations to function optimally under these conditions. Structural and functional adaptations may include:

    Structural Adaptations:

    1. Modified Surface Electrostatics - Increased negative surface charge through higher proportion of acidic residues (Asp, Glu) to maintain stability at high pH

    2. Altered Active Site pKa Values - Modified microenvironment around catalytic residues to maintain optimal charge states in alkaline conditions

    3. Enhanced Structural Rigidity - Additional salt bridges and hydrogen bonding networks to resist alkaline denaturation

    Functional Consequences:

    FeatureO. iheyensis lspANeutrophilic HomologsFunctional Impact
    pH activity profileActive at pH 8-11Active at pH 6-9Functions in alkaline environments
    Catalytic efficiencyOptimized for alkaline pHOptimized for neutral pHMaintains processing activity in extreme conditions
    Thermal stabilityEnhanced at high pHDecreases at high pHAllows function in combined thermal/pH stress
    Salt requirementsFunctions at high saltInhibited by high saltMaintains activity in saline environments

    Research on alkaliphilic enzymes shows they typically maintain activity and stability at pH values where mesophilic homologs are inactive . Comparative analysis with neutrophilic Bacillus species would help elucidate the specific adaptations of O. iheyensis lspA that enable its function in extreme environments.

  • How can site-directed mutagenesis be used to investigate critical residues in O. iheyensis lspA?

    Site-directed mutagenesis provides a powerful approach to dissect structure-function relationships in lspA:

    Strategic Mutation Targets:

    Residue TypePredicted FunctionMutation StrategyExpected Outcome
    Catalytic aspartatesDirect catalysisD→N or D→ALoss of catalytic activity
    Substrate-binding residuesLipobox recognitionConservative substitutionsAltered substrate specificity
    Membrane-interacting residuesMembrane integrationAlter hydrophobicityChanged membrane topology
    pH-sensing residuesAlkaline adaptationH→A, K→A, E→AModified pH optima

    Experimental Workflow:

    1. Identify conserved and variable residues through sequence alignment with homologous enzymes

    2. Generate point mutations using PCR-based site-directed mutagenesis

    3. Express and purify mutant proteins using standardized protocols

    4. Assess effects on:

      • Catalytic activity (using assays from Question 6)

      • Structural stability (circular dichroism, thermal shift assays)

      • Membrane association (fractionation studies)

      • pH and temperature optima (activity profiling)

    Validation Approaches:

    1. In vitro complementation with purified mutant enzymes

    2. In vivo complementation in lspA-deficient strains

    3. Structural analysis of mutant proteins

    4. Molecular dynamics simulations to model effects of mutations

    This systematic approach would identify residues critical for catalysis, substrate recognition, membrane association, and adaptation to alkaline environments, providing insights into the unique properties of O. iheyensis lspA.

  • What role do lipoproteins processed by lspA play in bacterial adaptation to extreme environments?

    Lipoproteins processed by lspA serve diverse functions critical for bacterial adaptation to extreme conditions:

    Key Lipoprotein Functions:

    1. Osmotic Regulation - Transport systems for compatible solutes

    2. pH Homeostasis - Components of proton pumps and ion transport systems

    3. Cell Wall Maintenance - Enzymes for peptidoglycan synthesis and modification

    4. Stress Response - Sensors and signal transduction components

    5. Nutrient Acquisition - ABC transporters and substrate-binding proteins

    In alkaliphilic Bacillus species, surface layer proteins and peptidoglycan synthesis play important roles in alkaline adaptation . The proper processing of lipoproteins involved in these processes would therefore be essential for survival in extreme environments.

    Research has shown that lipoprotein processing is particularly important for cell viability at temperature extremes , suggesting a critical role in stress response. In O. iheyensis, which faces multiple environmental stressors (high pH, high salinity, potentially variable temperatures), properly processed lipoproteins likely form a crucial component of its adaptive strategy.

    Research Approach for Investigation:

    1. Identify lipoprotein-encoding genes in the O. iheyensis genome through bioinformatic analysis

    2. Categorize these lipoproteins by predicted function

    3. Express recombinant versions of selected lipoproteins

    4. Assess their processing by O. iheyensis lspA under varying conditions

    5. Correlate processing efficiency with functional activity

  • How can comparative genomics inform our understanding of lspA evolution in extremophilic bacteria?

    Comparative genomics approaches provide valuable insights into the evolution and adaptation of lspA across bacterial species:

    Analytical Framework:

    1. Collect lspA sequences from diverse bacterial species, including:

      • Extremophiles (alkaliphiles, halophiles, thermophiles)

      • Mesophilic relatives (other Bacillus species)

      • Distant bacterial lineages

    2. Perform phylogenetic analysis to reconstruct evolutionary relationships

    3. Identify conserved regions indicating essential functional domains

    4. Detect signature patterns of positive selection in extremophile lineages

    Key Comparative Findings:

    FeatureExtremophilic lspAMesophilic lspAEvolutionary Significance
    Sequence conservationHigh in catalytic coreHigh in catalytic coreFundamental mechanism preserved
    Variable regionsMembrane interfaces, surface residuesMembrane interfaces, surface residuesAdaptation to specific environments
    Selection patternsPositive selection in surface-exposed regionsNeutral evolutionAdaptation to extreme conditions
    Genomic contextMay have specialized regulatorsStandard regulationSpecialized expression patterns

    The genome sequence of O. iheyensis, compared with other major Gram-positive bacterial species, suggests that the backbone of the genus Bacillus is composed of approximately 350 genes . Understanding how lspA has evolved within this core genome provides insights into essential bacterial processes and adaptation mechanisms.

    Comparative analysis of the O. iheyensis genome with other Bacillus species has already identified candidate genes involved in alkaliphily . Extending this approach to focus specifically on lspA and the lipoproteins it processes would further illuminate bacterial adaptation strategies to extreme environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.