Recombinant Oceanobacillus iheyensis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzyme Characteristics and Function

Lgt (EC 2.4.99.-) is a membrane-bound enzyme conserved across Gram-positive and Gram-negative bacteria. In O. iheyensis, it performs the first step in lipoprotein maturation:

  • Catalytic Activity: Transfers an sn-1,2-diacylglyceryl group to the sulfhydryl group of the conserved cysteine in prolipoproteins .

  • Biological Role: Essential for membrane anchoring of lipoproteins, which are critical for nutrient uptake, enzymatic activity, and host immune modulation .

Immune Modulation Studies

  • Lipoprotein Diversity: O. iheyensis Lgt produces N-acetylated lipoproteins, which differ from triacylated forms in Staphylococcus aureus or diacylated forms in Bacillus subtilis. This structural variation influences Toll-like receptor 2 (TLR2) signaling .

  • Comparative Analysis: Enzymes like Lgt enable studies on how lipid modifications affect pathogen-host interactions .

Industrial and Biotechnological Uses

  • Alkaliphilic Adaptation: The enzyme’s stability in extreme pH and salinity mirrors O. iheyensis’s deep-sea sediment habitat, making it a candidate for industrial processes under harsh conditions .

Genomic and Evolutionary Insights

  • Genomic Context: The lgt gene (OB2481) is part of a 3.6 Mb genome encoding osmotic/pH regulatory proteins .

  • Phylogenetic Conservation: Lgt homologs in Bacillus species share ~44–51% genomic collinearity, highlighting evolutionary conservation .

Comparative Lipid Modification in Firmicutes

SpeciesLipoprotein StructureKey Enzymes
O. iheyensisN-acetylated diacylglycerolLgt, Lit (intramolecular transacylase) .
S. aureusTriacylatedLgt, Lsp, LnsA/LnsB .
B. subtilisDiacylatedLgt, Lsp .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve catalytic mechanisms.

  • Drug Development: Targeting Lgt in pathogenic firmicutes (e.g., S. aureus) could yield novel antibiotics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lgt; OB2481; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Target Names
lgt
Target Protein Sequence
MLHTAAPIDRVAIEIGPLSIYWYGIIIAFGAILAIYLASKEADRLGLTKDLMLDFVMFAV PIAIIFARIYYVFFEFDQYANGPWWKVFAIWEGGIAIHGAVIGGVITAIVFAKVRKVSFW QIADIVAPSLILGQAIGRWGNFVNQEAHGGPISQATYESFHQYLPDFIMNQMTINGVMYH PTFLYESVWNILIFVGLLLLRKYNPVRGEVFLTYAITYSIGRYFIEGLRTDSLYMFDIIR TAQFISILIIIVSIIFIIYRRKTVSERYLDAPPSNKKKNKKSTKKKK
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links

KEGG: oih:OB2481

STRING: 221109.OB2481

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Oceanobacillus iheyensis and where was it first isolated?

Oceanobacillus iheyensis is an extremely halotolerant and alkaliphilic bacterium that was first isolated from deep-sea sediment collected at a depth of 1050m on the Iheya Ridge. The strain, designated HTE831 (JCM 11309, DSM 14371), represents a novel genus and species within the Bacillaceae family . This bacterium is particularly noteworthy for its ability to thrive in both high-salt and high-pH environments, making it an important model organism for studying microbial adaptation to extreme conditions.

The organism was characterized and proposed as a new genus and species based on phylogenetic analysis using 16S rDNA sequencing, chemotaxonomic studies, and physiological assessments . DNA-DNA hybridization experiments revealed low levels (12-30%) of relatedness between strain HTE831 and other known genera, confirming its status as a distinct taxonomic entity . The complete genome sequence was later determined, providing deeper insights into this organism's adaptive mechanisms.

What are the key characteristics of Oceanobacillus iheyensis strain HTE831?

Oceanobacillus iheyensis strain HTE831 possesses several distinctive characteristics that make it an intriguing subject for microbiological and biochemical research. This bacterium is Gram-positive, strictly aerobic, rod-shaped, and exhibits motility through peritrichous flagella . It has the ability to form spores, which likely contributes to its survival under adverse environmental conditions.

One of the most remarkable features of O. iheyensis is its exceptional halotolerance. The bacterium can grow in media containing 0-21% (w/v) NaCl at pH 7.5 and 0-18% at pH 9.5, with an optimum NaCl concentration of 3% at both pH levels . This ability to tolerate such wide ranges of salinity and pH distinguishes it from most other known bacteria and suggests specialized adaptive mechanisms.

The genome of O. iheyensis consists of 3.6 Mb, encoding numerous proteins potentially associated with regulation of intracellular osmotic pressure and pH homeostasis . Comparative genomic analyses reveal that approximately 350 genes form the backbone of the genus Bacillus, providing insight into the core genetic requirements of these widespread bacteria .

What is prolipoprotein diacylglyceryl transferase (lgt) and what is its function in bacteria?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme in bacterial lipoprotein biosynthesis, catalyzing the first step in the post-translational modification of bacterial lipoproteins. This enzyme (EC 2.4.99.-) transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox motif of prolipoproteins . This modification is crucial for proper anchoring of lipoproteins to the bacterial membrane.

The lgt protein from Oceanobacillus iheyensis (strain DSM 14371/JCM 11309/KCTC 3954/HTE831) is a membrane-associated enzyme with molecular characteristics adapted to function in the extremophilic environment where this bacterium thrives . The enzyme plays an integral role in bacterial physiology by facilitating the correct localization and function of numerous lipoproteins involved in various cellular processes, including:

  • Nutrient uptake and transport

  • Cell envelope integrity maintenance

  • Signal transduction

  • Stress response

  • Environmental adaptation

In extremophiles like O. iheyensis, the lgt enzyme and the lipoproteins it processes likely have specialized adaptations that enable their functionality under high salt concentrations and alkaline pH conditions. These adaptations may include modified substrate specificity, altered membrane interactions, and enhanced structural stability.

What genomic insights have been gained from studying Oceanobacillus iheyensis lgt?

The complete genome sequence of Oceanobacillus iheyensis HTE831 has provided valuable insights into the genetic basis of this organism's extremophilic adaptations. The lgt gene, designated by the ordered locus name OB2481, encodes a prolipoprotein diacylglyceryl transferase that plays a crucial role in membrane protein processing .

Genomic analysis reveals that O. iheyensis encodes many proteins potentially associated with regulating intracellular osmotic pressure and pH homeostasis, which are essential for survival in high-salt and high-pH environments . The candidate genes involved in alkaliphily were identified through comparative genomic analysis with three Bacillus species and two other Gram-positive species , highlighting the specialized adaptations that distinguish this extremophile.

Lateral gene transfer (LGT) has been identified as a significant factor in the evolution of the Bacillaceae family, including O. iheyensis . Analysis of gene presence/absence patterns across related species indicates that LGT is a major vehicle of gene acquisition when the number of gene families substantially increases from external taxa to members of certain Bacillus groups . This process has likely contributed to the acquisition of specialized genes that enable adaptation to extreme environments.

The evolutionary relationships between O. iheyensis and other Bacillus species can be traced through approximately 350 core genes that form the backbone of this genus . These shared genes provide insight into the fundamental genetic requirements for survival, while the unique genes in O. iheyensis likely contribute to its specialized lifestyle.

What expression systems are most suitable for producing functional recombinant O. iheyensis lgt?

Selecting appropriate expression systems for recombinant O. iheyensis lgt requires careful consideration of the protein's membrane-associated nature and extremophilic origin. The following table summarizes the most suitable expression systems and their respective advantages:

Expression SystemAdvantagesDisadvantagesRecommendations
E. coli BL21(DE3)High yield, well-established protocolsPotential misfolding of membrane proteinsUse with pET vectors and T7 promoter; supplement media with 3% NaCl
E. coli C41/C43Specialized for membrane proteinsLower yieldsBest for functional studies requiring proper folding
Bacillus subtilisCloser phylogenetic relation to native hostMore complex genetic manipulationConsider for native-like post-translational modifications
Pichia pastorisHigh-density cultivation, proper membrane environmentLonger expression timelineSuitable for large-scale production
Cell-free systemsDirect incorporation into liposomes or nanodiscsExpensive, limited scaleUseful for difficult-to-express variants

For O. iheyensis lgt expression, the following specific recommendations can improve functional yield:

  • Include affinity tags (His6, Strep-tag) for purification, preferably at the C-terminus to avoid interfering with membrane insertion

  • Consider fusion partners (MBP, SUMO) to enhance solubility and proper folding

  • Optimize codon usage for the selected expression host, addressing potential rare codons

  • Supplement growth media with 0.5-3% NaCl to mimic the preferred osmotic environment of O. iheyensis

  • Lower induction temperature (16-20°C) after induction to improve proper folding

These strategies address the challenges inherent in expressing functional membrane proteins from extremophilic sources and maximize the chances of obtaining properly folded, active enzyme for subsequent studies.

How does the structure of O. iheyensis lgt contribute to its function in extremophilic environments?

The structure of Oceanobacillus iheyensis lgt exhibits specialized adaptations that enable its function in high-salt and high-pH environments. While a complete crystal structure is not yet available, structural predictions based on sequence analysis and homology modeling reveal several key features that likely contribute to extremophilic adaptation:

Membrane topology analysis suggests that O. iheyensis lgt contains multiple transmembrane segments that anchor the protein in the cytoplasmic membrane, with catalytic domains properly positioned to access both cytoplasmic substrates and membrane phospholipids . This architecture is critical for the enzyme's function in transferring diacylglyceryl moieties to target proteins.

Adaptations to high salt conditions likely include:

  • An increased proportion of acidic residues on solvent-exposed surfaces, which provides enhanced hydration and stability in high-salt environments

  • Modified surface charge distribution that maintains protein solubility and prevents aggregation

  • Specialized salt bridges that contribute to structural stability

Adaptations to alkaline pH may include:

  • Adjusted pKa values of catalytic residues to maintain functionality at elevated pH

  • Structural elements that protect the active site from hydroxide ions

  • Enhanced secondary structure stability through increased hydrogen bonding networks

These structural adaptations collectively enable the enzyme to maintain its catalytic activity and structural integrity in the deep-sea environment where O. iheyensis was isolated, characterized by high pressure, high salinity (up to 21% NaCl), and alkaline pH (up to pH 9.5) . Understanding these structural features provides valuable insights for protein engineering applications aimed at enhancing enzyme stability under extreme conditions.

What role does lgt play in the adaptation of O. iheyensis to high-salinity and high-pH environments?

Prolipoprotein diacylglyceryl transferase (lgt) contributes significantly to the adaptation of Oceanobacillus iheyensis to high-salinity and high-pH environments through multiple direct and indirect mechanisms. By catalyzing the first step in bacterial lipoprotein maturation, lgt ensures the proper processing and localization of numerous membrane-associated proteins that are critical for survival under extreme conditions .

The genome of O. iheyensis encodes many proteins potentially associated with regulation of intracellular osmotic pressure and pH homeostasis . Many of these proteins require proper lipid modification by lgt to function effectively. These lipoproteins serve various functions that contribute to extremophilic adaptation:

  • Membrane integrity maintenance: Properly processed lipoproteins help maintain cell envelope structure and function, creating a protective barrier against ionic stress and pH fluctuations.

  • Osmotic regulation: Several lipoproteins function as components of compatible solute transport systems, which are essential for managing osmotic pressure in high-salt environments.

  • pH homeostasis: Lipoproteins involved in ion transport and exchange contribute to maintaining optimal internal pH despite the alkaline external environment.

  • Stress response coordination: Properly processed lipoproteins often function as signal transduction components that allow cells to respond appropriately to environmental challenges.

The importance of lgt in extremophilic adaptation is underscored by comparative genomic analyses showing that O. iheyensis shares approximately 350 core genes with other Bacillus species while possessing specialized genes for adaptation to its unique niche . This evolutionary specialization likely includes modifications to the lgt enzyme itself, enabling it to function optimally under conditions that would inactivate homologous enzymes from non-extremophilic bacteria.

How can site-directed mutagenesis be used to study the active site of O. iheyensis lgt?

Site-directed mutagenesis represents a powerful approach for investigating the structure-function relationships within the active site of Oceanobacillus iheyensis lgt. By systematically altering specific amino acid residues and analyzing the effects on enzyme activity under extreme conditions, researchers can delineate the catalytic mechanism and identify critical functional elements.

A comprehensive mutagenesis strategy for studying O. iheyensis lgt would include:

  • Target residue selection based on:

    • Conserved residues identified through multiple sequence alignment with lgt homologs

    • Predicted active site residues based on structural modeling

    • Residues unique to extremophilic lgt variants that may contribute to environmental adaptation

  • Mutation design approaches:

    • Conservative mutations (similar chemical properties) to assess structural importance

    • Non-conservative mutations to probe functional requirements

    • Alanine scanning to identify essential side chains

    • Mutations targeting specific adaptations to high salt or high pH conditions

  • Functional assessment methods:

    • Activity assays under varying conditions of salt concentration (0-21% NaCl) and pH (7.0-9.5)

    • Thermal stability comparisons between wild-type and mutant proteins

    • Substrate specificity analysis to identify alterations in enzyme-substrate interactions

    • Structural studies to correlate functional changes with structural perturbations

Key residues to target would include:

  • Catalytic residues directly involved in the transfer reaction

  • Substrate binding residues that position phospholipids and prolipoprotein targets

  • Membrane-interacting residues that anchor the enzyme in the lipid bilayer

  • Residues that may contribute to stability under extreme conditions

By systematically analyzing the effects of these mutations on enzyme activity and stability under varying conditions, researchers can develop a detailed model of the catalytic mechanism of O. iheyensis lgt and identify specific adaptations that enable its function in extreme environments. This information can contribute to our understanding of extremophilic adaptation and may inform protein engineering efforts aimed at enhancing enzyme stability for biotechnological applications.

What are the implications of lateral gene transfer involving lgt for the evolutionary history of O. iheyensis?

Lateral gene transfer (LGT) has played a significant role in shaping the genome of Oceanobacillus iheyensis and its adaptation to extreme environments. Analysis of the Bacillaceae phylogeny, including O. iheyensis, reveals high rates of gene insertion, particularly in certain bacterial groups, suggestive of adaptive evolution through LGT .

Studies employing maximum likelihood models to infer the rate of LGT in Bacillaceae evolution have shown that LGT is a major vehicle of gene acquisition . This has particular relevance for understanding how O. iheyensis acquired the specialized genetic toolkit needed to thrive in deep-sea, alkaline, high-salt environments. Several key implications emerge from these findings:

  • Acquisition of adaptive traits: LGT events likely contributed specialized genes, potentially including variants of lgt, that are adapted to extreme conditions. These transferred genetic elements could provide immediate fitness advantages in new environments.

  • Genomic innovation: Integration of foreign genes creates opportunities for new functionality. In the case of lgt and related genes, novel combinations may lead to modified protein processing capabilities that support survival under challenging conditions.

  • Taxonomic complexity: The network of gene exchanges revealed through LGT studies complicates traditional phylogenetic analyses. The evolutionary history of O. iheyensis involves both vertical inheritance and horizontal gene acquisition.

Research indicates that the Bacillaceae genome is rapidly expanding, and laterally transferred genes facilitate adaptive evolution and establishment in new ecological niches . Comparative analysis with other major Gram-positive bacterial species suggests that the backbone of the genus Bacillus is composed of approximately 350 genes , while specialized genes like those involved in extremophilic adaptation may have more complex evolutionary histories involving LGT.

The study of LGT patterns provides crucial context for understanding how specific genes like lgt have evolved in O. iheyensis and contributed to its remarkable ability to thrive in environments that would be hostile to most other organisms.

What purification strategies are most effective for isolating recombinant O. iheyensis lgt?

Purifying recombinant Oceanobacillus iheyensis lgt presents specific challenges due to its membrane-associated nature and the need to maintain its native conformation. The following comprehensive purification strategy addresses these challenges while maximizing yield and enzyme activity:

Initial extraction considerations:

  • Detergent selection is critical, with mild detergents (DDM, LDAO, or Triton X-100) generally preferred

  • Alternative approaches include styrene-maleic acid copolymer (SMA) extraction into native lipid nanodiscs

  • Buffer composition should include salt concentrations mimicking the optimal growth conditions of O. iheyensis (3% NaCl)

An optimized chromatographic purification sequence typically involves:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Ni-NTA or TALON resins for His-tagged constructs

    • Inclusion of detergent at concentrations above CMC in all buffers

    • Step gradient elution to separate differentially binding contaminants

  • Ion Exchange Chromatography:

    • Selection based on the predicted isoelectric point of O. iheyensis lgt

    • Useful for removing nucleic acid contaminants and misfolded species

    • Salt gradient optimization to accommodate the halophilic nature of the protein

  • Size Exclusion Chromatography:

    • Final polishing step to ensure homogeneity

    • Provides information about oligomeric state

    • Allows buffer exchange into optimal storage conditions

Special considerations for O. iheyensis lgt purification include:

  • pH optimization within the alkaliphilic range (potentially pH 7.5-9.5) improves stability

  • Addition of glycerol (10-20%) and specific lipids may preserve native conformation

  • Careful monitoring of detergent concentration throughout purification

Quality assessment should include:

  • SDS-PAGE and Western blotting to confirm identity and purity

  • Mass spectrometry to verify intact protein

  • Activity assays under conditions mimicking the native environment

  • Thermal shift assays to assess stability under various buffer conditions

This strategic approach to purification yields highly pure, functional O. iheyensis lgt suitable for subsequent structural and functional studies, while accommodating the unique properties of this extremophilic enzyme.

How can enzyme activity assays be optimized for O. iheyensis lgt under extreme conditions?

Developing and optimizing enzyme activity assays for Oceanobacillus iheyensis lgt under extreme conditions requires specialized approaches that account for the protein's extremophilic nature. The following methodological considerations address the challenges of assaying this enzyme under conditions that mimic its native environment:

Buffer system optimization:

  • Use buffers with appropriate pKa values for alkaline pH ranges (CAPS, CHES)

  • Ensure buffer capacity is sufficient to maintain pH stability at high salt concentrations

  • Include stabilizing agents (glycerol, specific lipids) to maintain enzyme structure

  • Create a matrix of conditions spanning pH 7.5-9.5 and NaCl concentrations of 0-21%

Substrate preparation strategies:

  • Radiolabeled or fluorescently-labeled phosphatidylglycerol substrates enable direct measurement

  • Synthetic peptide substrates containing the lipobox motif provide consistent material

  • Native O. iheyensis phospholipids, if available, better mimic natural conditions

  • Pre-test substrate stability under extreme conditions to ensure reliability

Detection method optimization should consider:

  • Direct activity measurement approaches:

    • TLC separation of lipidated peptides with appropriate detection methods

    • Mass spectrometry to detect modified peptide products

    • HPLC separation optimized for high-salt conditions

  • Controls and validation:

    • Include enzymes from non-extremophilic sources as comparative controls

    • Develop catalytically inactive mutants as negative controls

    • Confirm product formation using orthogonal analytical methods

Data analysis approaches should:

  • Apply appropriate correction factors for background effects of extreme conditions

  • Consider enzyme stability over time under each condition

  • Develop kinetic models that account for environmental factors

  • Compare activity profiles with homologous enzymes from non-extremophilic sources

Through systematic optimization of these parameters, researchers can develop robust assays that accurately characterize O. iheyensis lgt activity under conditions reflecting its natural extreme environment. These assays provide valuable insights into the adaptations that allow this enzyme to function effectively in deep-sea alkaline and high-salt habitats.

What are the best practices for storing and maintaining activity of recombinant O. iheyensis lgt?

Preserving the activity and stability of recombinant Oceanobacillus iheyensis lgt during storage requires specialized approaches that account for both its membrane-associated nature and extremophilic origin. The following best practices maximize enzyme stability and functional lifetime:

Short-term storage (1-2 weeks):

  • Storage temperature: 4°C is generally preferred over frozen storage for short terms

  • Buffer composition should include:

    • 50 mM Tris or HEPES buffer at pH 7.5-8.5

    • NaCl concentration of 3% (optimal for native enzyme)

    • 10-20% glycerol as cryoprotectant

    • Appropriate detergent at concentrations above CMC

    • Optional reducing agents (0.5-1 mM DTT or TCEP)

Long-term storage considerations:

  • Flash freezing in liquid nitrogen is preferred over slow freezing

  • Storage at -80°C rather than -20°C extends stability

  • Aliquoting prevents damaging freeze-thaw cycles

  • For detergent-solubilized protein, ensure detergent concentration remains above CMC

Specialized stabilization approaches include:

  • Lipid environment stabilization:

    • Addition of specific phospholipids maintains a native-like environment

    • Reconstitution into nanodiscs or liposomes enhances stability

    • Inclusion of lipids from halophilic sources may be beneficial

  • Osmolyte stabilization:

    • Addition of compatible solutes like ectoine or betaine (50-500 mM)

    • These natural stabilizers are found in extremophilic organisms

    • They help maintain protein structure during freeze-thaw cycles

Thawing and handling recommendations:

  • Rapid thawing at room temperature or 37°C water bath

  • Gentle mixing without vortexing prevents protein denaturation

  • Brief centrifugation removes any aggregates

  • Equilibration at working temperature before activity measurements

By implementing these specialized storage and handling protocols, researchers can maximize the stability and functional lifetime of recombinant O. iheyensis lgt, ensuring reliable and reproducible results in subsequent experimental studies.

What approaches are most effective for structural studies of O. iheyensis lgt?

Obtaining structural information for Oceanobacillus iheyensis lgt requires specialized approaches that address the challenges inherent in studying membrane-associated proteins from extremophiles. The following comprehensive methodology offers multiple pathways to structural characterization:

Sample preparation strategies:

  • Construct design optimization:

    • Removal of flexible regions identified through limited proteolysis

    • Creation of fusion constructs with crystallization chaperones

    • Surface entropy reduction through strategic mutations

    • Thermostabilizing mutations based on homology models

  • Protein engineering approaches:

    • Antibody fragment (Fab, nanobody) co-crystallization

    • Incorporation of stabilizing disulfide bonds

    • Truncation series to identify minimal functional domains

  • Lipid and detergent considerations:

    • Extensive detergent screening using vapor diffusion crystallization

    • Lipidic cubic phase (LCP) crystallization methods

    • Nanodisc reconstitution with defined lipid environments

Structural determination methods include:

For X-ray crystallography, specialized approaches include:

  • Microcrystallography at synchrotron beamlines

  • Serial crystallography for microcrystals

  • Multiple crystal averaging to improve data quality

  • Heavy atom derivatization for phase determination

These diverse approaches to structural characterization provide multiple avenues to understanding the three-dimensional architecture of O. iheyensis lgt. The resulting structural information can reveal the molecular basis for this enzyme's adaptation to extreme environments and inform protein engineering efforts aimed at creating enhanced biocatalysts for biotechnological applications.

How can the catalytic mechanism of O. iheyensis lgt be investigated?

Investigating the catalytic mechanism of Oceanobacillus iheyensis lgt requires a multifaceted approach combining biochemical, biophysical, and computational methods. The following methodological strategies provide complementary insights into how this enzyme functions in extreme environments:

Kinetic analysis approaches:

  • Steady-state kinetics under varying conditions of pH (7.5-9.5) and salt (0-21% NaCl)

  • Pre-steady-state kinetics to identify rate-limiting steps

  • Substrate specificity profiling using modified substrates

  • Inhibitor studies to probe binding interactions

Site-directed mutagenesis studies should target:

  • Predicted catalytic residues based on sequence conservation

  • Substrate binding residues identified through modeling

  • Residues potentially involved in extremophilic adaptation

  • Membrane interaction interfaces

Biophysical characterization methods:

  • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify dynamic regions

  • Fluorescence spectroscopy to monitor conformational changes

  • EPR spectroscopy if paramagnetic probes can be incorporated

Computational approaches:

  • Molecular dynamics simulations under conditions mimicking extreme environments

  • Quantum mechanics/molecular mechanics (QM/MM) to model the reaction pathway

  • Docking studies to identify substrate binding modes

  • Comparative analysis with homologous enzymes from non-extremophilic sources

Mechanistic investigation should particularly focus on:

  • The role of specific amino acids in substrate recognition and catalysis

  • The effects of salt concentration and pH on enzyme dynamics and activity

  • Comparison with homologous enzymes to identify extremophile-specific adaptations

  • The influence of membrane composition on enzyme function

Through the integration of these diverse methodological approaches, researchers can develop a comprehensive understanding of the catalytic mechanism of O. iheyensis lgt and the specific adaptations that enable its function in extreme environments. This knowledge contributes to our broader understanding of extremophilic adaptations and may inform protein engineering efforts for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.