Recombinant Oceanobacillus iheyensis Sensor protein lytS (lytS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
lytS; OB1642; Sensor protein LytS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Target Names
lytS
Target Protein Sequence
MIELTIVLFQRIGLLLLMAFILTRIPRFRSLLDKDITLKTVIYHSLIFGLISIIGAHVGV VMIGNELIMQAWIINVAENEVLIGFSIVVVMIAGLLGGPFLGLGTGMVAGLYIIFLGGGG WVANSLINPLAGLLTGWAGQFFSDDRVMSPNKALFIGIFPPVLHMGLLLIMLPDQQIGVQ IVNTIGIPLVVTNSIALTIFTMMIRLALNETEQEAALETNRALTIAEKALPLLSEEPGTM NARKMAKLLFKELDIAAISITNRTTVLSHVGLGDDHHQPGEPLKMRLSKKAVKDGRIQIA YHQSDIQCGVENCKLKTAIMVPIYRSGEVIGLINLYYRHSQQITAVEITLAKGLGTIISN QISGLEAEKMKKLLKEAKMRNLQAQINPHFLFNTFHLIHSLLRVDAEKARHILVQLSQFM RANLKIASESLVPLHKELEHLQAYLEIVQARFPDQISTSIHVDDYLLDIEIPPATLQPLV ENSIQHGLSLSTSKGILTINITKTDNNVSIVLLDNGQGFEEKLLPILGKKPLHQNENKGN GIALYNINQRLISLLGEDSQLHIQNTDKGSMVQFILPYRNCKKIM
Uniprot No.

Target Background

Function
LytS is a member of the two-component regulatory system LytS/LytT. It is believed to regulate genes involved in cell wall metabolism.
Database Links

KEGG: oih:OB1642

STRING: 221109.OB1642

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Oceanobacillus iheyensis Sensor protein LytS?

Recombinant Oceanobacillus iheyensis Sensor protein LytS is a histidine kinase protein belonging to the two-component regulatory system LytS/LytT. This protein is expressed recombinantly from the native sequence found in Oceanobacillus iheyensis strain DSM 14371/JCM 11309/KCTC 3954/HTE831, a deep-sea alkaliphilic and halotolerant bacterium . The protein functions as a sensor histidine kinase (EC 2.7.13.3) and plays a critical role in regulating genes involved in cell wall metabolism . When produced recombinantly, the protein typically contains 585 amino acids and may include various purification or solubility tags determined during the production process .

The protein's Uniprot accession number is Q8EQQ2, and its complete amino acid sequence includes distinctive domains for membrane spanning, sensing, and kinase activity . Structurally, LytS contains multiple transmembrane domains followed by cytoplasmic kinase domains that facilitate its sensory and signal transduction functions.

How does the LytS/LytT two-component regulatory system function in bacterial physiology?

The LytS/LytT two-component system operates through a phosphorelay mechanism that enables bacteria to sense and respond to environmental stimuli relevant to cell wall integrity and metabolism . The functional mechanism involves:

  • Detection of specific stimuli by the LytS sensor protein's extracellular or membrane-embedded sensing domains

  • Autophosphorylation of the histidine residue in the kinase domain using ATP

  • Transfer of the phosphoryl group to an aspartate residue on the cognate response regulator LytT

  • Activation of LytT's DNA-binding properties, leading to transcriptional regulation of target genes

This system regulates genes primarily involved in cell wall metabolism, peptidoglycan turnover, and potentially adaptation to stress conditions . The regulatory system's importance is particularly pronounced in bacteria adapting to extreme environments, such as the alkaliphilic and halotolerant conditions experienced by Oceanobacillus iheyensis.

What are the structural characteristics of the LytS protein?

The LytS protein exhibits several key structural features that define its functionality as a membrane-bound sensor kinase:

Domain TypeAmino Acid PositionFunction
Transmembrane domainsMultiple segmentsMembrane anchoring and potential sensory regions
PF02743CytoplasmicCache-like sensor domain
PF07694CytoplasmicSensor domain
PF06580CytoplasmicDimerization and phospho-acceptance
PF02518CytoplasmicHistidine kinase-like ATPase domain

The protein contains approximately seven transmembrane domains that anchor it within the cell membrane, with specific regions exposed to both extracellular and intracellular environments . The cytoplasmic portion contains the histidine kinase domain with ATP-binding capability (GO:0005524) and phosphorelay sensor kinase activity (GO:0000155) . The complete amino acid sequence reveals a protein rich in hydrophobic residues consistent with its membrane localization, along with functional motifs required for signal transduction .

How does the LytS protein contribute to the alkaliphilic adaptation of Oceanobacillus iheyensis?

The LytS protein plays a significant role in the alkaliphilic adaptation of Oceanobacillus iheyensis through its involvement in cell wall organization (GO:0071555) and potential pH-responsive signaling . Research findings indicate:

  • LytS functions within putative transport systems critical for the alkaliphilic adaptation of O. iheyensis HTE831

  • The protein remains functionally active even at neutral pH, suggesting structural adaptations that maintain functionality across pH gradients

  • As part of the cell's sensing apparatus, LytS likely contributes to detecting and responding to pH changes that affect cell wall integrity

Proteomic analysis of O. iheyensis has identified LytS among proteins that participate in alkaliphilic adaptation mechanisms . The bacterium's ability to thrive in environments with pH values above 9.0 depends partly on maintaining cell wall integrity under conditions that would typically compromise structural stability. The LytS/LytT system appears to regulate genes involved in modifications to peptidoglycan composition and cell wall properties that enhance resistance to alkaline conditions.

What molecular mechanisms underlie LytS-mediated phosphorelay signaling?

The LytS protein employs sophisticated molecular mechanisms for phosphorelay signaling that involve several distinct steps and domains:

  • Stimulus Detection: The transmembrane and extracellular domains of LytS detect specific environmental signals related to cell wall integrity or stress

  • Signal Transduction: Conformational changes in the protein structure propagate the signal across the membrane

  • Autophosphorylation: The cytoplasmic histidine kinase domain (PF02518) binds ATP (GO:0005524) and catalyzes the transfer of the γ-phosphate to a conserved histidine residue

  • Phosphotransfer: The phosphoryl group is subsequently transferred to an aspartate residue on the response regulator LytT

  • Response Activation: Phosphorylated LytT undergoes conformational changes that enhance its DNA-binding affinity, leading to altered gene expression patterns

This process requires precise coordination between the protein's sensory domains and its kinase activity. The LytS protein possesses specific structural adaptations that allow it to function as part of the bacterium's environmental sensing network, responding to stimuli that potentially indicate cell wall stress or damage .

How have proteomic approaches enhanced our understanding of LytS function?

Proteomic analysis has significantly advanced our understanding of LytS function within the broader context of bacterial physiology and adaptation:

  • Multidimensional proteomic studies of O. iheyensis have identified LytS within the insoluble sub-proteome, confirming its membrane localization and providing insights into its physical associations with other membrane components

  • Proteomic approaches have revealed LytS's presence in functional networks associated with cell wall organization and alkaliphilic adaptation

  • The identification of post-translational modifications through MS/MS analysis has illuminated regulatory mechanisms affecting LytS activity

Research employing both gel-based and gel-free proteomics has enabled comprehensive characterization of the O. iheyensis proteome, including the identification of 153 proteins from 467 uniquely identified peptides . These studies have positioned LytS within the functional context of other membrane proteins and regulatory systems, particularly those involved in environmental adaptation. Through proteomic classification, researchers have been able to assign functions to previously hypothetical proteins that interact with or are regulated by the LytS/LytT system.

What are the optimal conditions for expressing and purifying recombinant LytS protein?

The successful expression and purification of recombinant LytS protein requires specific conditions that address the challenges associated with membrane proteins:

ParameterRecommended ConditionRationale
Expression systemYeast or E. coli with membrane protein optimizationProper folding of transmembrane domains
InductionLow temperature (16-18°C)Reduces inclusion body formation
DetergentMild non-ionic detergents (DDM, LDAO)Solubilization without denaturation
PurificationIMAC followed by size exclusion chromatographyTwo-step purification for >85% purity
Buffer compositionTris-based buffer with 50% glycerolMaintains stability during storage
Storage-20°C for short-term, -80°C for extended periodsPrevents protein degradation

When working with recombinant LytS, it is essential to consider the protein's membrane-associated nature . The expression in yeast systems has been reported to yield functional protein . After purification, the protein should be stored in conditions that prevent degradation and maintain activity, typically in a Tris-based buffer containing 50% glycerol .

The purification strategy should accommodate the hydrophobic nature of the transmembrane domains while maintaining the native conformation required for functional studies. Repeated freeze-thaw cycles should be avoided, and working aliquots should be stored at 4°C for no more than one week .

What methodological approaches are effective for studying LytS-LytT interactions?

Several methodological approaches have proven effective for investigating the interactions between LytS and its cognate response regulator LytT:

  • Bacterial Two-Hybrid Systems:

    • Allow detection of protein-protein interactions in a cellular context

    • Can be adapted for membrane proteins by using split-ubiquitin systems

    • Provide semi-quantitative assessment of interaction strength

  • Surface Plasmon Resonance (SPR):

    • Enables real-time monitoring of binding kinetics

    • Requires purified components in detergent micelles or nanodiscs

    • Provides quantitative binding constants (ka, kd, KD)

  • Isothermal Titration Calorimetry (ITC):

    • Measures thermodynamic parameters of binding

    • Useful for determining stoichiometry and energetics

    • Complements SPR data with complete thermodynamic profile

  • Phosphotransfer Assays:

    • Direct measurement of kinase activity and phosphorelay

    • Typically uses radiolabeled ATP (γ-32P) or phospho-specific antibodies

    • Monitors the functional outcome of LytS-LytT interaction

  • Fluorescence Resonance Energy Transfer (FRET):

    • Creates fusion proteins with fluorescent tags

    • Allows dynamic monitoring of interactions in real-time

    • Can be performed in intact cells or with purified components

These methods should be selected based on the specific research question and available resources. For comprehensive characterization, a combination of approaches is often necessary to validate interactions and understand their functional significance in the context of bacterial signal transduction.

How can experimental design address the challenges of studying membrane-associated proteins like LytS?

Studying membrane-associated proteins like LytS presents unique challenges that require specialized experimental designs:

  • Solubilization Strategies:

    • Systematic screening of detergents to identify conditions that maintain native protein structure

    • Use of amphipols or nanodiscs to provide a more native-like membrane environment

    • Application of styrene-maleic acid lipid particles (SMALPs) for extraction with surrounding lipids

  • Structural Characterization:

    • Cryo-electron microscopy for structure determination in a near-native state

    • X-ray crystallography with lipidic cubic phase crystallization

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

  • Functional Reconstitution:

    • Development of proteoliposome systems that mimic the native membrane environment

    • Establishment of solid-supported membrane electrophysiology for activity measurement

    • Creation of minimal cell wall fragments for stimulus detection studies

  • In vivo Analysis:

    • Generation of fluorescent protein fusions that preserve functionality

    • Application of site-specific in vivo cross-linking to capture transient interactions

    • Development of genetic reporter systems linked to LytS/LytT activity

When designing experiments for LytS, researchers should explicitly control for potential artifacts introduced by detergents or recombinant tags. The experimental design should follow systematic approaches similar to those used in the proteomic analysis of O. iheyensis, where multidimensional techniques were employed to overcome the challenges of analyzing membrane proteins .

How can researchers integrate proteomic data to understand LytS function in cellular processes?

Integrating proteomic data to understand LytS function requires sophisticated analytical approaches:

  • Network Analysis:

    • Construction of protein-protein interaction networks based on co-occurrence in proteomic datasets

    • Identification of functional modules associated with LytS activity

    • Application of graph theory algorithms to identify key nodes and pathways

  • Comparative Proteomics:

    • Differential expression analysis between wild-type and lytS mutant strains

    • Comparison of proteomes under different environmental conditions (pH, osmolarity)

    • Cross-species analysis to identify conserved functional associations

  • Pathway Enrichment:

    • Statistical analysis to identify over-represented biological processes among LytS-regulated proteins

    • Integration with metabolomic data to connect proteome changes with metabolic shifts

    • Temporal analysis to distinguish primary from secondary effects

  • Structural Proteomics Integration:

    • Combination of cross-linking mass spectrometry data with structural models

    • Analysis of post-translational modifications affecting LytS activity

    • Correlation between protein stability measurements and functional outputs

In the case of O. iheyensis, researchers have successfully employed automated curation tools like PROVALT to refine proteomic datasets from thousands of peptide identifications to hundreds of high-confidence protein identifications . This approach allowed the functional classification of previously hypothetical proteins and established connections between LytS and other components of alkaliphilic adaptation mechanisms.

What bioinformatic approaches are most effective for analyzing LytS structure and function?

Several bioinformatic approaches have proven particularly valuable for analyzing LytS structure and function:

  • Sequence Analysis:

    • Multiple sequence alignment to identify conserved functional residues

    • Phylogenetic analysis to understand evolutionary relationships

    • Domain prediction to map functional regions (transmembrane, sensing, kinase)

  • Structural Prediction:

    • Homology modeling based on related histidine kinases with known structures

    • Ab initio and threading approaches for regions lacking homologous templates

    • Molecular dynamics simulations to explore conformational dynamics

  • Systems Biology Integration:

    • Genome context analysis to identify functionally related genes

    • Regulon prediction based on consensus binding sites for LytT

    • Metabolic modeling to predict physiological consequences of LytS/LytT activation

  • Machine Learning Applications:

    • Classification of potential stimuli based on protein features

    • Prediction of interaction partners through co-evolution analysis

    • Identification of regulatory patterns through text mining of research literature

For the LytS protein specifically, bioinformatic analysis has identified key functional domains including seven transmembrane segments, a PF02743 domain, a PF07694 sensor domain, a PF06580 dimerization domain, and a PF02518 histidine kinase-like ATPase domain . These predictions have guided experimental approaches by highlighting regions of interest for functional studies and providing context for interpreting experimental results.

How should researchers approach contradictory data regarding LytS function?

When faced with contradictory data regarding LytS function, researchers should employ a systematic approach to resolution:

  • Methodological Reconciliation:

    • Evaluate differences in experimental conditions (pH, temperature, ionic strength)

    • Compare protein preparation methods (tags, purification strategy, storage)

    • Assess assay sensitivity and specificity for each contradictory finding

  • Contextual Analysis:

    • Consider strain-specific genetic backgrounds

    • Evaluate growth conditions and physiological state of cells

    • Assess potential cross-talk with other two-component systems

  • Integrative Hypothesis Development:

    • Formulate models that accommodate apparently contradictory findings

    • Design critical experiments specifically targeting points of contradiction

    • Apply Bayesian approaches to weight evidence based on methodological rigor

  • Community Standards Implementation:

    • Apply standardized reporting criteria for experimental conditions

    • Implement minimum information standards for data sharing

    • Utilize open science practices to enable direct comparison and replication

In addressing contradictions, researchers should consider the multifunctional nature of LytS and its integration into complex cellular networks. The protein's role may vary depending on environmental conditions, particularly given its involvement in adaptive responses to alkaline environments . A systems-level perspective that considers both direct and indirect effects can often reconcile apparently contradictory observations.

What are the future research directions for understanding LytS function?

Future research on LytS function should focus on several promising directions:

  • Stimulus Identification:

    • Determination of the specific molecular signals sensed by LytS

    • Characterization of the sensing mechanism at the molecular level

    • Development of biosensors based on LytS sensing domains

  • Structural Biology:

    • Complete structure determination in different functional states

    • Elucidation of conformational changes during signal transduction

    • Mapping of interaction interfaces with LytT and other partners

  • Systems Biology:

    • Comprehensive mapping of the LytS/LytT regulon

    • Integration with other regulatory networks responding to cell wall stress

    • Modeling of the temporal dynamics of LytS-mediated responses

  • Biotechnological Applications:

    • Engineering of LytS variants with altered specificity

    • Development of antimicrobial compounds targeting the LytS/LytT system

    • Creation of synthetic biology tools based on LytS sensing capabilities

The study of LytS continues to benefit from advances in proteomic methodologies, as demonstrated by the multidimensional analysis of O. iheyensis . Future research will likely leverage emerging technologies such as single-molecule approaches, advanced imaging techniques, and computational modeling to achieve a more comprehensive understanding of this important regulatory protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.