Recombinant Oceanobacillus iheyensis UPF0059 membrane protein OB2993 (OB2993)

Shipped with Ice Packs
In Stock

Description

Functional Insights

OB2993 belongs to the UPF0059 protein family, which is implicated in manganese transport. Key functional features include:

  • Role in Metal Homeostasis: Predicted to function as a manganese efflux pump (MntP), aiding in detoxification by exporting excess Mn²⁺ .

  • Structural Motifs: Contains transmembrane domains typical of ion transporters, with conserved residues critical for metal binding and transport .

  • Adaptation Mechanism: Likely contributes to O. iheyensis’ survival in extreme environments (high alkalinity and salinity) by regulating intracellular metal concentrations .

Research Applications

This recombinant protein is primarily used in:

  • Mechanistic Studies: Investigating bacterial metal resistance and transport pathways.

  • Structural Biology: Potential target for crystallization and cryo-EM studies (though no published structures exist for OB2993 specifically) .

  • Biochemical Assays: Functional characterization via ELISA and binding studies .

Comparative Analysis with Related Proteins

While OB2993’s structure remains uncharacterized, studies on other O. iheyensis macrodomain proteins (e.g., OiMacroD) reveal conserved features:

FeatureOB2993 (MntP)OiMacroD
Primary FunctionMn²⁺ effluxADP-ribose hydrolysis
Structural MotifsTransmembrane helicesα/β fold with conserved active-site waters
Catalytic ResiduesPutative metal-binding sitesAsp40, Asn30, Gly37
Substrate SpecificityMn²⁺ ionsO-acetyl-ADP-ribose

Research Gaps and Future Directions

  • Structural Data: No high-resolution structure of OB2993 is available, limiting mechanistic insights.

  • In Vivo Validation: Functional role in metal resistance requires confirmation via knockout studies.

  • Biotechnological Potential: Exploration in bioremediation or industrial metal recovery processes.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mntP; OB2993; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Target Names
mntP
Target Protein Sequence
MPFTSEIISIILLAIGLSMDGFSVSLGLGMQQLRLKRIAYIGLTIGFLHMLMPLAGMLLG QVISEQIGQWTSFAGGVLLFLIGAHMFFSAFRLTEGFRWQPVGVGLWIIAFSVSLDSFTV GLGLGISGVQIFVTLFAFGIVSCFLTWLGMLIGRKVYRFLGVYSELLGGSILCGFGIFIL FS
Uniprot No.

Target Background

Function
Putative manganese efflux pump.
Database Links

KEGG: oih:OB2993

STRING: 221109.OB2993

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Oceanobacillus iheyensis UPF0059 membrane protein OB2993?

Recombinant Full Length Oceanobacillus iheyensis UPF0059 membrane protein OB2993 (OB2993) is a 182-amino acid membrane protein (UniProt ID: Q8EM65) that can be expressed with an N-terminal His-tag in E. coli expression systems . It belongs to the UPF0059 protein family, which contains membrane proteins with currently uncharacterized functions. The recombinant version is typically expressed as a fusion protein with affinity tags to facilitate purification and downstream applications in structural and functional studies.

What expression systems are suitable for OB2993 protein production?

The OB2993 protein can be successfully expressed using several systems, with E. coli being the most commonly documented host for recombinant production . For researchers requiring higher purity and functionality, cell-free expression systems like the MembraneMax™ Protein Expression Kit may provide advantages for membrane protein production . These cell-free systems utilize nanolipoprotein particles (NLPs) to create a membrane-like environment that promotes proper folding and stability of membrane proteins during synthesis, minimizing aggregation issues common with traditional expression methods .

What are the typical yields for OB2993 expression in different systems?

Expression yields vary depending on the system used. The table below summarizes typical yields based on optimized protocols:

Expression SystemTypical Yield RangeAdvantagesLimitations
E. coli (standard)0.5-2 mg/L cultureCost-effective, scalablePotential inclusion body formation
Cell-free (MembraneMax™)Microgram to milligram per 100 μL reactionRapid (4 hours), proper foldingHigher cost per mg protein
Insect cell expression1-5 mg/L cultureBetter folding than E. coliMore complex setup, longer timeline

While specific yield data for OB2993 is limited in the literature, cell-free expression systems can generally produce microgram to milligram quantities of membrane proteins in a homogeneous population . The actual yield will depend on optimization of reaction conditions for this specific protein.

What is the optimal protocol for expressing OB2993 using cell-free systems?

For optimal expression of OB2993 using cell-free systems such as MembraneMax™, the following methodology is recommended:

  • Template preparation: Generate a DNA template containing the OB2993 gene with appropriate regulatory elements (T7 promoter, Shine-Dalgarno sequence, and proper start/stop codons) .

  • Reaction setup:

    • Combine 20 μL E. coli extract, 20 μL reaction buffer, 1.25 μL amino acid mixture (minus methionine), 1 μL methionine, 2 μL MembraneMax™ reagent, 1 μL T7 enzyme mix, and 1 μg purified DNA template .

    • Adjust volume to 50 μL with nuclease-free water .

  • Incubation:

    • Incubate at 30-37°C with shaking at 1,200 rpm for 30 minutes .

    • Prepare and add 50 μL feed buffer (containing 2X IVPS feed buffer, amino acids, methionine, and water) .

    • Continue incubation for an additional 2-4 hours to maximize protein yield .

  • Analysis:

    • Assess expression by SDS-PAGE, Western blotting, or functional assays .

This protocol typically yields functional membrane protein within 4 hours, making it significantly faster than traditional cell-based expression systems that may require days .

What purification strategy provides the highest purity and yield for OB2993?

Purification of His-tagged OB2993 protein can be accomplished using the following optimized protocol:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • For His-tagged OB2993, equilibrate a Ni-NTA column with binding buffer (typically 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole) .

    • Apply the protein sample and wash with binding buffer containing 20-30 mM imidazole to remove non-specifically bound proteins.

    • Elute the protein with elution buffer containing 250-300 mM imidazole.

  • Size Exclusion Chromatography (SEC):

    • Further purify the IMAC-purified protein using SEC to remove aggregates and obtain a monodisperse protein preparation.

    • Use a buffer system that maintains membrane protein stability (typically containing a mild detergent or lipid nanodisc components).

  • Detergent exchange (if necessary):

    • If the protein was expressed in a cell-free system with nanodiscs, it may be maintained in this form for downstream applications.

    • For applications requiring detergent-solubilized protein, exchange into the appropriate detergent system during purification.

The combination of IMAC and SEC typically yields >90% pure protein suitable for structural and functional studies. When working with membrane proteins, maintaining proper folding throughout purification is critical for preserving function.

How can I assess the structural integrity and proper folding of purified OB2993?

Assessing structural integrity and proper folding of OB2993 requires a multi-technique approach:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-250 nm) provides information about secondary structure content (α-helices, β-sheets).

    • Near-UV CD (250-350 nm) reports on tertiary structure through aromatic amino acid environments.

    • Compare spectra with theoretical predictions based on sequence analysis.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

    • Determines the oligomeric state and homogeneity of the purified protein.

    • Monodisperse peaks suggest properly folded protein, while multiple peaks or aggregation indicate potential folding issues.

  • Tryptophan Fluorescence:

    • Intrinsic fluorescence of tryptophan residues is sensitive to the local environment.

    • Changes in emission spectra upon denaturation can indicate native folding state.

  • Thermal Stability Assays:

    • Differential scanning calorimetry (DSC) or differential scanning fluorimetry (DSF) to determine melting temperature.

    • Well-folded membrane proteins typically exhibit cooperative unfolding transitions.

  • Limited Proteolysis:

    • Partially digesting the protein with proteases can reveal accessible regions.

    • Comparing digestion patterns between different preparations can indicate consistent folding.

Each of these methods provides complementary information about protein structure, and using multiple approaches strengthens confidence in proper folding assessment.

What strategies can overcome expression challenges specific to OB2993?

Membrane proteins like OB2993 often present expression challenges. Consider the following strategies to overcome common issues:

  • Codon Optimization:

    • Adjust codon usage to match the expression host, potentially increasing expression levels by 2-10 fold.

    • Focus on rare codons that might cause translation pauses and affect folding.

  • Fusion Partners:

    • Beyond His-tags, consider fusion with solubility-enhancing partners such as MBP, SUMO, or thioredoxin.

    • Include a TEV protease cleavage site for tag removal post-purification.

  • Expression Condition Optimization Matrix:

    • Test multiple parameters systematically:

    ParameterVariables to Test
    Temperature16°C, 25°C, 30°C, 37°C
    Induction timingEarly log, mid-log, late log phase
    Inducer concentration0.1-1.0 mM IPTG (for E. coli)
    Media compositionLB, TB, 2YT, minimal media + supplements
    AdditivesGlycerol (5-10%), glucose (0.5-2%), osmolytes
  • Cell-free Expression Modifications:

    • For MembraneMax™ systems, optimize DNA template concentration (0.5-2.0 μg per reaction).

    • Adjust reaction temperature (30°C versus 37°C) and incubation time (2-6 hours) .

    • Modify lipid composition in nanodiscs to better match native membrane environment.

  • Consider Alternative Expression Hosts:

    • Beyond E. coli, evaluate Bacillus subtilis (as a Gram-positive host more similar to Oceanobacillus), Pichia pastoris, or mammalian cell lines for challenging membrane proteins.

These strategies should be tested systematically, documenting yields and protein quality with each modification.

How can I design functional assays to characterize the unknown function of OB2993?

Since UPF0059 family proteins have uncharacterized functions, a systematic approach to functional characterization is necessary:

  • Bioinformatic Analysis:

    • Perform sequence homology searches against characterized proteins.

    • Identify conserved domains or motifs that might suggest function.

    • Use structure prediction tools to identify potential binding pockets or active sites.

  • Ligand Binding Screens:

    • Thermal shift assays with compound libraries to identify potential ligands that stabilize the protein.

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to validate and quantify binding interactions.

  • Protein-Protein Interaction Studies:

    • Pull-down assays with cellular extracts from Oceanobacillus iheyensis.

    • Yeast two-hybrid or bacterial two-hybrid screening.

    • Cross-linking studies followed by mass spectrometry.

  • Enzymatic Activity Screens:

    • Test for common membrane protein functions (transporter, channel, enzyme).

    • Design assays based on:

      • Transport assays (if suspected transporter)

      • Ion flux measurements (if suspected channel)

      • Enzymatic activity screens with various substrates

  • Mutational Analysis:

    • Create alanine scanning mutants of conserved residues.

    • Test effects on stability, potential binding, or activity.

  • Cellular Localization and Context:

    • Expression studies in the native organism to determine expression patterns.

    • Knockout/complementation studies to assess phenotypic effects.

A properly designed functional characterization approach often begins with broader screens that narrow down to focused hypotheses, which are then tested with targeted experiments.

What are the critical parameters for optimizing OB2993 expression in cell-free systems?

When optimizing cell-free expression of OB2993, the following parameters have the most significant impact on yield and quality:

  • Template Quality and Concentration:

    • Ensure high-purity DNA template (OD260/280 ratio >1.8).

    • Optimize template concentration (typically 500-1000 ng/μL) .

    • The positioning of the gene relative to the T7 promoter and Shine-Dalgarno sequence affects expression efficiency .

  • Reaction Component Ratios:

    • The ratio of E. coli extract to reaction buffer can be adjusted (standard is 20 μL:20 μL for a 100 μL reaction) .

    • Optimizing amino acid concentrations may improve yield.

  • Incubation Conditions:

    • Temperature (30°C vs. 37°C) affects both speed and yield .

    • Reaction time (standard 2-4 hours, but can be extended up to 6 hours).

    • Shaking speed (1,200 rpm recommended for proper mixing) .

  • Feed Buffer Timing and Composition:

    • The feed buffer replenishes depleted components after the initial reaction phase .

    • Timing of feed buffer addition (standard is 30 minutes after reaction start) .

  • Nanolipoprotein Composition:

    • The MembraneMax™ reagent provides nanodiscs with DMPC lipids .

    • For specialized applications, consider supplementing with additional lipids that better mimic the native membrane environment.

Systematic optimization experiments testing these parameters can improve yields by 2-5 fold compared to standard conditions. Document all changes carefully to establish an optimized protocol specific to OB2993.

How can I troubleshoot poor expression or solubility issues with OB2993?

When encountering expression or solubility challenges with OB2993, implement this systematic troubleshooting approach:

Create a detailed troubleshooting log documenting all conditions tested and results observed to establish patterns that may reveal the underlying issues.

How can structural characterization techniques be applied to OB2993?

Structural characterization of OB2993 can be approached using complementary techniques:

Each method provides different information, and combining multiple approaches gives the most comprehensive structural understanding of OB2993. The choice of methods should align with specific research questions and available resources.

What insights can comparative analysis provide about OB2993 function?

Comparative analysis offers valuable insights when direct functional assays are challenging:

  • Phylogenetic Analysis:

    • Compare UPF0059 family proteins across diverse species.

    • Identify evolutionary patterns and co-evolution with other proteins.

    • Construct phylogenetic trees to determine relationship with functionally characterized proteins.

  • Structural Comparison:

    • Compare predicted or determined structures with known membrane proteins.

    • Identify structural motifs associated with specific functions (e.g., transport, enzymatic activity).

    • Use structural alignments to detect potential functional sites not obvious from sequence alone.

  • Genomic Context Analysis:

    • Examine neighboring genes in the Oceanobacillus iheyensis genome.

    • Identify conserved gene clusters across species suggesting functional relationships.

    • Look for co-regulation patterns that might indicate participation in specific pathways.

  • Expression Pattern Correlation:

    • Analyze under what conditions the native OB2993 is expressed.

    • Identify co-expressed genes that might function in the same pathway.

    • Compare expression patterns with proteins of known function.

  • Interactome Analysis:

    • Identify proteins that interact with OB2993 or its homologs.

    • Map these interactions to known cellular pathways.

    • Use this network to generate functional hypotheses.

Combining these comparative approaches often reveals functional clues that direct experimental approaches might miss, particularly for understudied protein families like UPF0059.

What are the most promising research directions for understanding OB2993 function?

Based on current knowledge about UPF0059 membrane proteins and available methodologies, several promising research directions emerge:

  • Integrative Structural Biology:

    • Combining cryo-EM, crystallography, and computational modeling to determine the complete structure.

    • Using this structural information to identify potential binding pockets or functional domains.

  • Systems Biology Approaches:

    • Knockout/knockdown studies in native organisms or model systems.

    • Metabolomic and proteomic profiling to detect cellular changes associated with OB2993 manipulation.

    • Transcriptomic analysis to identify co-regulated genes.

  • High-Throughput Screening:

    • Development of biosensor assays using purified OB2993.

    • Screening compound libraries for interactions that might reveal function.

    • Testing for potential enzymatic activities with diverse substrate panels.

  • Computational Prediction and Validation:

    • Using advanced machine learning algorithms to predict function from sequence and structure.

    • Validating these predictions with targeted biochemical assays.

    • Molecular dynamics simulations to understand protein behavior in membrane environments.

  • Synthetic Biology Applications:

    • Engineering OB2993 variants with enhanced or modified functions.

    • Using OB2993 as a scaffold for novel membrane protein applications.

    • Investigating potential biotechnological applications based on discovered functions.

These directions, particularly when pursued in parallel, maximize the chances of significant breakthroughs in understanding this uncharacterized membrane protein.

How can I design experiments to resolve conflicting data about OB2993?

When facing conflicting experimental results about OB2993, implement this systematic resolution strategy:

  • Standardize Experimental Conditions:

    • Ensure all comparative experiments use identical protein preparations.

    • Standardize buffer compositions, temperatures, and analytical methods.

    • Document all parameters meticulously to identify subtle differences.

  • Employ Orthogonal Techniques:

    • Validate observations using multiple independent methodologies.

    • For example, if conflicting binding data exists:

      • Confirm with both biophysical methods (ITC, SPR) and functional assays.

      • Use both purified systems and cellular contexts.

  • Consider Protein State Variables:

    • Test if protein oligomerization state affects results.

    • Evaluate the impact of different detergents or lipid environments.

    • Assess if post-translational modifications might explain discrepancies.

  • Perform Rigorous Controls:

    • Include both positive and negative controls in all experiments.

    • Test related proteins to determine specificity of observations.

    • Use mutant variants as internal controls.

  • Collaborative Validation:

    • Engage collaborators to independently repeat critical experiments.

    • Exchange materials and protocols to identify sources of variation.

    • Consider round-robin testing across multiple laboratories.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.