Recombinant Oceanobacillus iheyensis UPF0295 protein OB0906 (OB0906)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
OB0906; UPF0295 protein OB0906
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Target Names
OB0906
Target Protein Sequence
MSQQLTYSSKINKIRTFALILVFAGIITMYGGILTKNIEWLMVIFFILGTLMVILSCAVY VWIGTLSLRAVPVICPSCEKPTKMLGRVDACMHCKQPLTMDKNLEGIEFDEKYNSRKYKK K
Uniprot No.

Target Background

Database Links

KEGG: oih:OB0906

STRING: 221109.OB0906

Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OB0906 protein and what organism does it originate from?

OB0906 is a UPF0295 family protein derived from Oceanobacillus iheyensis, a deep-sea bacterium isolated from sediment at a depth of 1,050 meters . The bacterium is the type species of its genus and is characterized by extreme halotolerance and alkaliphilic properties . The protein consists of 121 amino acids and has been recombinantly produced with an N-terminal His-tag for research applications . The full protein has been assigned the UniProt ID Q8CV51, indicating its recognition in protein databases .

What are the basic physical properties of recombinant OB0906 protein?

PropertySpecificationNotes
Length121 amino acidsFull-length protein
TagN-terminal HisFacilitates purification
SourceE. coli expression systemRecombinant production
FormLyophilized powderFor storage stability
Purity>90%As determined by SDS-PAGE
Storage BufferTris/PBS-based buffer with 6% TrehalosepH 8.0

The protein's physical properties make it suitable for various biochemical and structural studies . The presence of a His-tag facilitates purification while maintaining functionality for most research applications.

What is the optimal protocol for reconstituting lyophilized OB0906 protein?

For optimal reconstitution of lyophilized OB0906 protein, follow this evidence-based protocol:

  • Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Aliquot for long-term storage at -20°C/-80°C to prevent repeated freeze-thaw cycles

This protocol maximizes protein stability while preserving structural integrity . The addition of glycerol serves as a cryoprotectant to prevent protein denaturation during freezing. For experiments requiring different buffers, consider a gradual buffer exchange via dialysis to prevent protein precipitation.

How should researchers design experiments to study OB0906 function in the context of bacterial adaptation to extreme environments?

When designing experiments to investigate OB0906's function in environmental adaptation:

  • Comparative expression analysis: Quantify OB0906 expression levels under varying pH conditions (pH 7-11) and salt concentrations (0-20% NaCl) to determine if expression correlates with environmental stress .

  • Gene knockout studies: Create OB0906-deficient O. iheyensis strains to assess growth and survival under alkaline and high-salt conditions compared to wild type.

  • Protein interaction assays: Perform pull-down assays with purified His-tagged OB0906 to identify binding partners that might be involved in adaptation pathways .

  • Structure-function analysis: Generate site-directed mutants of key residues (especially in the conserved domains) to determine their importance in protein function under stress conditions.

  • Heterologous expression: Express OB0906 in non-alkaliphilic bacteria to test whether it confers increased tolerance to alkaline or high-salt conditions.

These approaches should be conducted with appropriate controls, including comparison with related Bacillus species that aren't alkaliphilic, to isolate the specific contributions of OB0906 .

What are the recommended storage conditions for maintaining OB0906 protein stability for long-term research?

For maintaining optimal stability of OB0906 protein in research settings:

  • Long-term storage: Store at -20°C/-80°C in aliquots containing 50% glycerol to prevent freeze-thaw damage

  • Working solutions: Store at 4°C for up to one week; repeated freezing and thawing is not recommended

  • Lyophilized form: Store the original lyophilized powder at -20°C in a desiccator

  • Buffer considerations: Maintain pH at 8.0 (consistent with the protein's alkaliphilic origin)

Researchers should verify protein integrity after extended storage by SDS-PAGE or functional assays appropriate to their experimental design . Activity loss over time should be documented to establish reliable experimental timelines.

How can researchers utilize OB0906 to study bacterial adaptations to alkaline and high-salt environments?

OB0906 can serve as a model protein for investigating extremophile adaptations through several advanced approaches:

  • Comparative genomics: Analyze OB0906 within the context of the 243 proteins shared exclusively between O. iheyensis and B. halodurans (another alkaliphile) to elucidate alkaliphily-specific adaptation mechanisms .

  • Structural biology: Determine the three-dimensional structure of OB0906 using X-ray crystallography or cryo-EM to identify unique structural features that might contribute to function under extreme conditions.

  • Molecular dynamics simulations: Model OB0906 behavior under varying pH and salt concentrations to predict conformational changes and stability parameters.

  • Synthetic biology applications: Engineer OB0906 and related proteins into non-extremophilic organisms to develop strains with enhanced tolerance to industrial alkaline or high-salt conditions.

  • Evolutionary analysis: Compare OB0906 to homologs in the approximately 350 genes that form the backbone of the Bacillus genus to trace the evolution of alkaliphily .

This multifaceted approach leverages the unique properties of O. iheyensis as an alkaliphilic and halotolerant organism to understand fundamental mechanisms of environmental adaptation at the molecular level.

What methodological approaches can address the challenges in expressing and purifying membrane-associated proteins like OB0906?

Membrane-associated proteins like OB0906 present unique purification challenges that can be addressed through specialized methodologies:

  • Detergent screening: Systematically test multiple detergents (non-ionic, zwitterionic, and mild ionic) for optimal solubilization while maintaining native conformation.

  • Expression optimization:

    • Reduce expression temperature (16-20°C)

    • Use specialized E. coli strains (C41/C43) designed for membrane protein expression

    • Consider cell-free expression systems for difficult-to-express constructs

  • Purification strategies:

    • Two-phase extraction systems for initial enrichment

    • Immobilized metal affinity chromatography (IMAC) optimized for detergent-containing buffers

    • Size exclusion chromatography to remove aggregates

  • Stability verification:

    • Circular dichroism to confirm secondary structure integrity in different detergent environments

    • Thermal shift assays to identify conditions that enhance stability

  • Alternative expression hosts:

    • Consider Bacillus-based expression systems that might better accommodate proteins from related organisms

    • For structural studies, insect cell or mammalian expression may provide better folding for complex membrane proteins

These approaches should be empirically optimized for OB0906 specifically, as membrane protein behavior can vary significantly even within the same protein family.

How can researchers effectively study the potential role of OB0906 in pH homeostasis mechanisms?

To investigate OB0906's potential role in pH homeostasis:

  • pH-dependent activity assays:

    • Measure protein activity across pH 6-11 range to determine optimal functional pH

    • Compare activity profiles with homologs from non-alkaliphilic bacteria

  • Ion flux measurements:

    • Monitor proton/ion transport in reconstituted liposomes containing purified OB0906

    • Use pH-sensitive fluorescent probes to track pH changes in real-time

  • Protein-protein interaction studies:

    • Identify binding partners using co-immunoprecipitation under varying pH conditions

    • Map interactions to known pH homeostasis systems in extremophiles

  • Mutational analysis:

    • Target conserved charged residues that might participate in ion binding or transport

    • Perform complementation studies in pH-sensitive bacterial strains

  • Transcriptional regulation:

    • Characterize expression patterns of OB0906 in response to pH shifts

    • Identify potential regulatory elements in the promoter region responsive to pH stress

This comprehensive approach would generate significant insights into whether OB0906 directly participates in maintaining cytoplasmic pH in an alkaline environment or serves as part of a larger adaptive mechanism.

How does OB0906 compare with homologous proteins in other Bacillus-related species?

Comparative analysis of OB0906 with homologous proteins reveals important evolutionary and functional insights:

SpeciesProtein HomologyEnvironmental NicheNotable Differences
O. iheyensisOB0906 (reference)Deep-sea alkaliphile, halotolerantAdapted to high pressure, alkaline pH
B. haloduransClosest homologSoil alkaliphileLacks deep-sea adaptations
B. subtilisDistant homologSoil neutrophileLacks alkaliphilic adaptations
O. kimchiiRelated homologModerately haloalkaliphilicDifferent salt tolerance profile

Based on genomic analyses, OB0906 belongs to a subset of 243 proteins shared exclusively between O. iheyensis and B. halodurans, suggesting these proteins may play key roles in alkaliphily . The protein shows adaptations consistent with the extreme environment of its native host, including potential membrane-associated functions that could contribute to maintaining cellular homeostasis under alkaline conditions.

Phylogenetic analysis places OB0906 within the context of the approximately 350 genes that form the backbone of the Bacillus genus, providing insights into how this protein family evolved specialized functions for extreme environment adaptation .

What genomic context surrounds the OB0906 gene in O. iheyensis and what can this reveal about its function?

The genomic context of OB0906 within the 3.6 Mb O. iheyensis genome provides valuable clues about its potential biological roles:

  • Conserved neighborhood analysis: Examination of genes consistently co-localized with OB0906 across related species can reveal functional relationships and potential operonic structures.

  • Genomic islands: Determining whether OB0906 resides within regions showing anomalous GC content or codon usage might indicate horizontal gene transfer events that contributed to environmental adaptation.

  • Regulatory elements: Identification of promoter motifs shared with other stress-responsive genes could link OB0906 to specific environmental response pathways.

  • Comparative synteny: Analysis of the approximately 980 orthologs that maintain conserved genomic positions across Bacillus-related species can provide context for understanding whether OB0906's genomic location is evolutionarily significant .

  • Transcriptional unit mapping: RNA-seq data analysis could determine if OB0906 is co-expressed with neighboring genes, suggesting functional relationships.

This genomic context analysis is particularly valuable given that O. iheyensis possesses numerous genes potentially associated with regulation of intracellular osmotic pressure and pH homeostasis, which may include OB0906 as part of these adaptive networks .

What methodological approaches can researchers use to determine the precise membrane topology of OB0906?

To determine the membrane topology of OB0906, researchers should employ a multidisciplinary approach:

  • Computational prediction:

    • Apply multiple transmembrane prediction algorithms (TMHMM, TopPred, HMMTOP)

    • Use hydropathy analysis to identify potential membrane-spanning regions

    • Predict topology based on positive-inside rule for bacterial membrane proteins

  • Experimental verification:

    • PhoA/LacZ fusion analysis: Create fusion proteins at different positions to determine cytoplasmic/periplasmic orientation

    • Cysteine scanning mutagenesis combined with accessibility studies

    • Protease protection assays to identify protected (membrane-embedded) regions

  • Structural studies:

    • Epitope tagging at predicted loops followed by antibody accessibility testing

    • Fluorescence resonance energy transfer (FRET) to measure distances between domains

    • Cryo-EM or X-ray crystallography of the purified protein in membrane mimetics

  • In vivo probing:

    • GFP-fusion analysis combined with fluorescence microscopy to confirm localization

    • Cross-linking studies to identify neighboring proteins that could constrain topology

These complementary approaches would provide a robust determination of OB0906's membrane orientation, essential for understanding its functional role in the context of the alkaliphilic adaptations of O. iheyensis.

How can researchers investigate potential post-translational modifications of OB0906 and their functional significance?

Investigation of post-translational modifications (PTMs) of OB0906 requires systematic analytical approaches:

  • Mass spectrometry-based identification:

    • High-resolution LC-MS/MS analysis of purified OB0906

    • Enrichment techniques for specific modifications (e.g., phosphopeptide enrichment)

    • Quantitative proteomics to compare modification states under different conditions

  • Site-specific mutagenesis:

    • Mutation of predicted modification sites to non-modifiable residues

    • Functional assays comparing wild-type and mutant proteins

    • Creation of phosphomimetic mutations (e.g., Ser/Thr to Asp/Glu) to test functional effects

  • In vitro modification assays:

    • Incubation with O. iheyensis lysates to identify endogenous enzymatic modifications

    • Radiolabeling experiments to detect dynamic modification events

    • Chemical biology approaches using modification-specific probes

  • Physiological relevance:

    • Compare modification patterns under different environmental stressors (pH, salt)

    • Temporal analysis of modifications during adaptation to changing conditions

    • Correlation of modification states with protein activity or localization

This comprehensive approach would reveal whether OB0906 undergoes PTMs that might regulate its function in response to environmental conditions, potentially contributing to the remarkable adaptability of O. iheyensis to extreme alkaline and saline environments.

What are the main challenges in determining the precise biological function of OB0906?

Determining the precise biological function of OB0906 presents several significant research challenges:

  • Protein family limitations:

    • UPF0295 is an uncharacterized protein family with limited functional information

    • No known enzymatic activity or binding partners established in the literature

    • Structural information is lacking for the entire protein family

  • Technical challenges:

    • Potential membrane association complicates expression and purification

    • Extremophile proteins may require specialized conditions for activity assays

    • Reconstitution of the native environment (high pH, salt) may be difficult in vitro

  • Genetic manipulation barriers:

    • Limited genetic tools available for O. iheyensis compared to model organisms

    • Creating clean knockouts in extremophiles often presents technical difficulties

    • Complementation studies may be complicated by unknown regulatory elements

  • Functional redundancy:

    • Potential overlapping functions with other proteins may mask phenotypes in single knockout studies

    • Multiple systems for pH and osmotic homeostasis could obscure the specific role of OB0906

Future research should address these challenges through interdisciplinary approaches combining structural biology, comparative genomics, and development of genetic tools specifically for extremophilic Bacillus relatives.

What emerging technologies could advance our understanding of OB0906 and similar proteins from extremophile bacteria?

Several cutting-edge technologies show promise for advancing research on OB0906 and related extremophile proteins:

  • Cryo-electron microscopy advances:

    • High-resolution structural determination of membrane proteins without crystallization

    • Visualization of OB0906 in different conformational states under varying conditions

    • Potential for visualizing protein-protein interaction complexes in near-native environments

  • CRISPR-Cas9 adaptation for extremophiles:

    • Development of extremophile-specific genome editing tools

    • Precise manipulation of OB0906 in its native context

    • Creation of regulated expression systems for functional studies

  • Single-cell technologies:

    • Analysis of OB0906 expression at the single-cell level during environmental transitions

    • Correlation of expression with cellular physiology metrics

    • Spatial proteomics to determine precise subcellular localization

  • Artificial intelligence applications:

    • Improved structural prediction through AlphaFold and similar tools

    • Machine learning analysis of large-scale phenotypic data to predict function

    • Network analysis to place OB0906 in broader adaptive response pathways

  • Synthetic biology approaches:

    • Creation of minimal functional constructs to isolate essential domains

    • Engineering OB0906 variants with enhanced properties for biotechnological applications

    • Development of biosensors based on OB0906 for detecting environmental parameters

These technologies, especially when used in combination, could overcome many current limitations in studying proteins from extremophilic organisms and provide unprecedented insights into adaptation mechanisms.

How does studying OB0906 contribute to our broader understanding of bacterial adaptation to extreme environments?

Research on OB0906 contributes significantly to our understanding of bacterial adaptation through several conceptual frameworks:

  • Comparative genomics insights: OB0906 exists within a subset of 243 proteins shared exclusively between alkaliphilic species, suggesting its potential role in alkaline adaptation mechanisms . This comparative approach helps identify the minimal genetic requirements for extreme environment colonization.

  • Evolutionary adaptation models: By studying proteins like OB0906 that may have evolved specialized functions, researchers can trace molecular adaptation pathways and understand how organisms colonize extreme ecological niches.

  • Structure-function relationships: The potential membrane association of OB0906 contributes to our understanding of how protein structure adapts to maintain functionality under extreme pH or salt conditions.

  • Systems biology perspective: Positioning OB0906 within the broader network of approximately 350 genes that form the backbone of the Bacillus genus helps illuminate how core biological functions are maintained across diverse environmental conditions .

  • Biotechnological applications: Insights gained from studying extremophile proteins like OB0906 can inform the engineering of more robust enzymes and cellular systems for industrial applications in challenging conditions.

This research ultimately connects molecular mechanisms to ecological adaptation, providing insights that span from protein structure to evolutionary biology.

What are promising future research directions for OB0906 that could yield significant scientific insights?

Several high-potential research directions for OB0906 could yield transformative insights:

  • Integrative structural biology:

    • Combining computational prediction, cryo-EM, and functional studies to develop a complete structural-functional model

    • Visualization of conformational changes under varying pH and salt conditions

  • Synthetic biology applications:

    • Engineering OB0906 and related proteins into industrial microorganisms to enhance alkaline tolerance

    • Development of biosensors for environmental monitoring based on OB0906's environmental responsiveness

  • Comparative analysis across diverse extremophiles:

    • Expanding analysis beyond the current Bacillus relatives to include distantly related alkaliphiles

    • Testing for convergent evolution in adaptation mechanisms

  • Systems-level adaptation studies:

    • Positioning OB0906 within global regulatory networks responding to environmental stress

    • Integration with metabolomics and transcriptomics data to create comprehensive adaptation models

  • Ecological significance investigation:

    • Studying the role of OB0906 and related proteins in microbial community formation in extreme environments

    • Assessing competitive advantages conferred by these specialized proteins in natural settings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.