Recombinant Oceanobacillus iheyensis UPF0316 protein OB0738 (OB0738)

What is Oceanobacillus iheyensis UPF0316 protein OB0738?

OB0738 is a protein from Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831), classified as an UPF0316 family protein. This protein consists of 197 amino acids with the sequence: mLENAFImLAIIFSVNVIYVSLMTVRMILTLKGRTYIAAFVSMFEIVIYVVGLGLVLDNL DQIQNLVAYAIGFGTGLVIGAKIEEKLALGYITVNVVSANPDLKFTQRLREKGYGVTSWS SYGREGDRLSVQILTPRKYELRLYETIQEIDPKAFIISYEPKRIHGGFWVKQVRKGKLMN PKKKKNTNTVESENEQK . The UniProt accession number for this protein is Q8ESA3, which allows researchers to access additional information about its predicted structure and function in database resources. The "UPF" designation (Uncharacterized Protein Family) indicates that while the protein has been identified and sequenced, its precise biological function remains to be fully elucidated through experimental characterization.

What is known about the organism Oceanobacillus iheyensis?

Oceanobacillus iheyensis HTE831 is an extremophilic bacterium isolated from deep-sea sediment collected at a depth of 1050 meters. This organism exhibits both alkaliphilic (thriving in alkaline environments) and extremely halotolerant properties (able to withstand high salt concentrations) . These adaptations make O. iheyensis particularly interesting for studying protein evolution and adaptation mechanisms to extreme environments. The genome of O. iheyensis contains unique features including five copies of group II introns (designated as Oi.Int) that demonstrate interesting splicing behaviors . The extremophilic nature of this organism suggests that its proteins, including OB0738, may possess unique structural and functional properties adaptable to harsh environmental conditions, making them valuable for both basic research and potential biotechnological applications.

How should recombinant OB0738 protein be properly stored and handled?

For optimal stability and activity of recombinant OB0738 protein, storage at -20°C is recommended for routine use, while -80°C is preferred for extended storage periods . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for maintaining protein stability . When working with the protein, it's advisable to create small working aliquots that can be stored at 4°C for up to one week to minimize protein degradation . Researchers should avoid repeated freeze-thaw cycles as this can significantly compromise protein integrity and activity . For experiments requiring high protein quality, freshly thawed aliquots should be used, and any remaining protein should not be refrozen. When manipulating the protein for experimental purposes, maintaining appropriate buffer conditions and temperature control is essential to preserve the native conformation and functional properties.

What expression systems are optimal for producing recombinant OB0738?

Multiple expression systems can be employed for the production of recombinant OB0738, each offering distinct advantages depending on research objectives. Bacterial expression in E. coli (particularly strains like BL21(DE3), JM115, or Rosetta-GAMI) represents the most straightforward and cost-effective approach for high-yield production . For applications requiring eukaryotic post-translational modifications, yeast systems (SMD1168, GS115, X-33) offer a compromise between prokaryotic simplicity and advanced modifications . Insect cell lines (Sf9, Sf21, High Five) can be utilized for complex protein folding requirements, while mammalian expression systems (293, 293T, CHO) provide the most sophisticated post-translational modification capabilities . When selecting an expression system, researchers should consider factors such as required protein yield, purification strategy, downstream applications, and the need for specific post-translational modifications that may affect protein function or structure.

How do different fusion tags affect OB0738 protein solubility and function?

The choice of fusion tag significantly impacts the solubility, purification efficiency, and potentially the function of recombinant OB0738. Common tags include His-tag (hexahistidine), which allows for simple metal affinity purification but may not enhance solubility significantly . For proteins with solubility challenges, larger tags such as MBP (Maltose Binding Protein) or GST (Glutathione S-Transferase) often improve folding and solubility while providing affinity purification options . Other fusion options include FLAG-tag (for immunodetection), TrxA (thioredoxin, for enhanced solubility), Nus (for improved expression and solubility), Biotin (for strong binding interactions), and GFP (for visualization and solubility) . The position of the tag (N-terminal vs. C-terminal) can also significantly impact protein folding and function, requiring optimization for each specific application . Researchers should consider conducting parallel expression trials with different tags to determine the optimal configuration for their specific experimental needs.

What purification strategies yield the highest purity OB0738 protein?

Obtaining high-purity OB0738 protein typically requires a multi-step purification strategy, beginning with an affinity chromatography step based on the fusion tag employed. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) serves as an effective initial capture step . Following tag-based purification, size exclusion chromatography (SEC) can separate the target protein from aggregates and other contaminants based on molecular size . For applications requiring extremely high purity (>95%), additional steps such as ion exchange chromatography or hydrophobic interaction chromatography may be necessary . The purification process should be optimized based on the specific experimental requirements:

Post-purification processing may include protein renaturation, endotoxin removal, filtration sterilization, and lyophilization depending on downstream applications .

What functional assays are suitable for characterizing the activity of OB0738?

Since OB0738 belongs to the UPF0316 family with currently uncharacterized function, designing appropriate functional assays represents a significant challenge. A systematic approach should begin with bioinformatic analysis to identify potential functional domains, conserved residues, or structural similarities to characterized proteins. Based on the observation that O. iheyensis possesses other functionally interesting proteins like OiMacroD (which catalyzes the hydrolysis of O-acetyl-ADP-ribose) , researchers might consider testing for enzymatic activities such as hydrolase, isomerase, or nucleic acid-binding functions. Thermal and pH stability assays are particularly relevant given the extremophilic nature of the source organism . For membrane-associated functions (suggested by the amino acid sequence containing potential transmembrane regions) , reconstitution into liposomes or nanodiscs might be necessary to assess potential transport or signaling activities. Protein-protein interaction studies using pull-down assays, yeast two-hybrid, or co-immunoprecipitation with O. iheyensis lysates could identify binding partners that provide functional clues.

How should researchers design site-directed mutagenesis experiments to probe OB0738 function?

When designing site-directed mutagenesis experiments for OB0738, researchers should employ a strategic approach based on sequence analysis, structural predictions, and evolutionary conservation. First, perform multiple sequence alignment of UPF0316 family proteins to identify highly conserved residues, which are likely critical for structure or function. Computational tools for predicting functional residues (based on electrostatic properties, solvent accessibility, and evolutionary conservation) can guide selection of initial mutation targets. The amino acid sequence suggests potential transmembrane regions that could be systematically altered to assess membrane association functions . If crystallographic data becomes available (as it did for OiMacroD ), targeting of specific structural elements would be more precise. Based on the extremophilic nature of O. iheyensis, mutations affecting salt bridges or hydrophobic interactions could reveal adaptations to extreme environments. A systematic alanine-scanning approach of conserved motifs offers a comprehensive strategy when functional information is limited. For each mutant, researchers should conduct both structural validation (to ensure proper folding) and functional assays to distinguish between residues important for structural integrity versus catalytic or binding functions.

How might OB0738 function differ from homologous proteins in non-extremophilic organisms?

Analyzing the potential functional differences between OB0738 and its homologs in non-extremophilic organisms requires consideration of the unique environmental adaptations of Oceanobacillus iheyensis. As an alkaliphilic and extremely halotolerant organism isolated from deep-sea sediment at 1050m depth , O. iheyensis has likely evolved proteins with distinctive properties. Comparative sequence analysis would reveal unique residues or motifs in OB0738 that might confer enhanced stability under high salt conditions or alkaline pH. Structural adaptations might include increased surface negative charges to bind hydration water more tightly, reduced hydrophobic core packing, or specific salt bridge arrangements that contribute to halotolerance. Functional differences could manifest as altered substrate specificity, catalytic efficiency across different pH ranges, or novel interaction partners specific to extreme environments. Experimental approaches to investigate these differences would include heterologous expression of OB0738 homologs from non-extremophiles, followed by comparative biochemical characterization under varying salt concentrations and pH conditions. Such comparative studies would provide insights into protein evolution and adaptation mechanisms while potentially revealing unique functional properties with biotechnological applications.

What insights about OB0738 can be gained from the structural and functional analysis of OiMacroD?

Although OB0738 and OiMacroD represent different protein families from Oceanobacillus iheyensis, the structural and functional characterization of OiMacroD provides valuable methodological insights applicable to OB0738 research. The successful crystallization and structure determination of OiMacroD, including its mutant variants (D40A, N30A, and G37V), demonstrates that proteins from this extremophile can be effectively expressed, purified, and crystallized . The OiMacroD study identified critical water molecules in the substrate binding pocket and revealed the importance of loop conformational changes for substrate recognition . Similarly, a comprehensive approach combining crystallography with mutational analysis could reveal structure-function relationships in OB0738. The OiMacroD study successfully characterized both binding and catalytic properties by systematically analyzing substrate interactions and enzyme kinetics . This integrated approach combining structural biology with biochemical characterization represents a template for investigating OB0738, particularly in identifying potential ligands, cofactors, or substrates. Additionally, the identification of OiMacroD's role in hydrolyzing O-acetyl-ADP-ribose and reversing protein mono-ADP-ribosylation suggests that O. iheyensis proteins may have evolved specialized functions related to nucleotide metabolism or post-translational modifications worth investigating in OB0738 .

How might alternative splicing of group II introns in O. iheyensis impact the expression and function of proteins like OB0738?

The discovery of alternative splicing mechanisms involving group II introns in Oceanobacillus iheyensis raises intriguing questions about potential impacts on protein expression and function throughout its proteome, including proteins like OB0738. Research has identified five copies of group II introns (Oi.Int) in the O. iheyensis genome, with evidence that these introns can undergo splicing at unexpected sites and participate in host gene transcription . This alternative splicing capability could potentially generate protein isoforms with altered functions, a mechanism that might have contributed to the organism's adaptation to extreme environments. For OB0738, researchers should investigate whether its gene contains any of these introns or if its expression is regulated by alternative splicing events. Transcriptome analysis comparing O. iheyensis under different environmental conditions might reveal condition-specific isoforms of various proteins, including OB0738. The alternative 5' splicing observed in mutant introns suggests a mechanism for generating functional diversity that "presumably has influenced past adaptations of O. iheyensis to various environmental changes" . Understanding these mechanisms could provide insights into the evolution of extremophile adaptation strategies and potentially reveal novel regulatory pathways affecting protein expression and function.

How can researchers overcome challenges in expressing membrane-associated proteins like OB0738?

The amino acid sequence of OB0738 suggests it may contain transmembrane regions, which presents specific challenges for recombinant expression and purification . To overcome these challenges, researchers should consider specialized expression strategies. Expressing the protein with fusion partners specifically designed for membrane proteins (such as Mistic or SUMO) can enhance proper membrane insertion and folding . Selection of appropriate detergents during extraction and purification is critical—starting with a detergent screen including mild options like DDM, LMNG, or digitonin can identify optimal solubilization conditions. For structural and functional studies, reconstitution into lipid nanodiscs or liposomes may be necessary to maintain native conformation and activity. Expression in eukaryotic systems (particularly insect cells) often improves the yield of properly folded membrane proteins . Cell-free expression systems provide another alternative, allowing direct incorporation into artificial membranes during synthesis. For proteins proving particularly recalcitrant to expression, computational analysis can identify soluble domains that might be expressed independently for initial characterization. Finally, expression at reduced temperatures (16-20°C) often improves membrane protein folding by slowing the production rate and allowing more time for proper membrane insertion.

What approaches can resolve data inconsistencies in OB0738 functional characterization?

When confronted with inconsistent data during OB0738 functional characterization, researchers should implement a systematic troubleshooting approach. First, assess protein quality through multiple analytical methods (SDS-PAGE, mass spectrometry, circular dichroism) to ensure that inconsistencies are not due to protein degradation, aggregation, or improper folding. Different buffer conditions can significantly impact protein behavior—especially for proteins from extremophiles—so standardizing and documenting exact buffer compositions, pH, and salt concentrations is essential. The presence or absence of fusion tags can affect functional properties, necessitating parallel testing of tagged and tag-cleaved versions . For enzymatic assays, careful consideration of substrate purity, enzyme concentration, and reaction conditions is critical for reproducibility. When activity results vary between batches, implementing appropriate controls including known active enzymes in parallel reactions can identify systemic issues. Given O. iheyensis' extremophilic nature, testing activity across a broad range of conditions (pH, salt concentration, temperature) might reveal condition-dependent functions that explain apparent inconsistencies . Finally, independent verification using complementary assay methods provides the strongest evidence for functional assignments and helps resolve contradictory results.

How can comparative genomics and evolutionary analysis enhance understanding of OB0738 function?

Leveraging comparative genomics and evolutionary analysis can provide crucial insights into the potential function of uncharacterized proteins like OB0738. Researchers should begin with comprehensive homology searches using tools like HMMER or HHpred that can detect distant relationships beyond standard BLAST searches. Analyzing the genomic context of OB0738 and its homologs across species can reveal conserved gene neighborhoods (synteny), suggesting functional associations or metabolic pathways. Phylogenetic profiling—identifying co-occurring genes across multiple genomes—can highlight proteins that functionally interact with OB0738. Examining the evolutionary rate of sequence divergence can identify constrained regions under purifying selection, indicating functional importance. For extremophiles like O. iheyensis, comparing homologs across organisms from different extreme environments may reveal adaptations specific to alkaline, halophilic, or deep-sea conditions versus general extremophile adaptations . Integration with transcriptomic data showing co-expression patterns can further support functional hypotheses. Advanced approaches like ancestral sequence reconstruction can identify key mutations that emerged during adaptation to extreme environments. These computational approaches generate testable hypotheses about protein function that can guide targeted experimental design, substantially accelerating functional characterization of this uncharacterized protein family.

What potential biotechnological applications might emerge from studying OB0738?

The study of OB0738 from Oceanobacillus iheyensis could yield several promising biotechnological applications, particularly due to the extremophilic nature of the source organism. Proteins from extremophiles often possess enhanced stability under harsh conditions, making them valuable biocatalysts for industrial processes requiring high temperatures, extreme pH, or high salt concentrations . If OB0738 demonstrates enzymatic activity, it could potentially serve as a novel biocatalyst for industrial or pharmaceutical applications that must operate under alkaline conditions or high salt concentrations. The potential membrane-associated properties suggested by its amino acid sequence might indicate roles in selective transport or sensing, which could be exploited for developing biosensors or selective membrane technologies . Understanding the structural basis of protein stability in this extremophile could inform protein engineering strategies for enhancing stability of other industrial enzymes. Additionally, if OB0738 interacts with nucleic acids (a possibility given that O. iheyensis contains interesting group II introns) , it might have applications in molecular biology techniques requiring salt-tolerant DNA/RNA-binding proteins. The systematic characterization of proteins like OB0738 contributes to our fundamental understanding of protein adaptation mechanisms, potentially enabling rational design of proteins with enhanced stability for diverse biotechnological applications.

How might crystallography and cryo-EM approaches be optimized for structural determination of OB0738?

Structural determination of OB0738 would provide invaluable insights into its function and adaptation mechanisms. Based on successful approaches with other proteins from O. iheyensis like OiMacroD , researchers should consider several optimization strategies. For X-ray crystallography, extensive crystallization screening is essential, with particular attention to conditions mimicking the native environment of this halotolerant organism (including higher salt concentrations). Surface entropy reduction through targeted mutagenesis of surface residues with high conformational entropy (clusters of lysine, glutamate, and glutamine) can improve crystal quality. If the full-length protein resists crystallization, computational analysis can identify stable domains that might crystallize more readily. For cryogenic electron microscopy (cryo-EM), particle size may be a limitation since OB0738 is relatively small (197 amino acids) . This challenge might be addressed by engineering fusion constructs with larger proteins or using antibody fragments to increase molecular weight. Researchers might also explore peptidisc or nanodisc technologies if OB0738 has membrane-associated properties. Leveraging computational approaches like AlphaFold2 can provide initial structural models to guide experimental design and interpretation. Successful structural determination would likely require iterative optimization of protein constructs, purification conditions, and crystallization or vitrification parameters, potentially yielding crucial insights into adaptation mechanisms of proteins in extremophilic organisms.

What role might OB0738 play in the adaptation of O. iheyensis to extreme environments?

Understanding the potential role of OB0738 in extremophile adaptation requires integrating multiple lines of evidence. The amino acid sequence suggests membrane-associated properties, raising the possibility that OB0738 contributes to membrane integrity or selective permeability under extreme conditions . Proteins involved in maintaining membrane functionality are particularly important for extremophiles, as the cell membrane represents a critical interface with harsh environments. Comparative genomics approaches examining the conservation and distribution of UPF0316 family proteins across extremophiles versus mesophiles could indicate whether this protein family has been specifically selected during adaptation to extreme environments. Transcriptomic and proteomic studies examining expression changes under varying stress conditions (pH, salt concentration, temperature) would reveal whether OB0738 is differentially regulated during stress response. The sophisticated alternative splicing mechanisms identified in O. iheyensis involving group II introns suggest complex regulatory networks that may influence the expression and function of multiple proteins including OB0738 . If the gene encoding OB0738 contains or is regulated by these introns, it might generate condition-specific protein variants that contribute to environmental adaptation. Gene knockout or knockdown studies, if technically feasible in this organism, would provide the most direct evidence of OB0738's role in extremophile adaptation and potentially reveal unexpected functions of this uncharacterized protein family.