Recombinant Oceanobacillus iheyensis UPF0365 protein OB1959 (OB1959)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; OB1959; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-330
Protein Length
full length protein
Species
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Target Names
OB1959
Target Protein Sequence
MENSIILPIIIIAAVLIALAILFTFVPVALWISALAAGVKISIFTLIGMRLRRVVPNRVI NPLIKAHKAGLNVKTNQLESHYLAGGNVDRVVNALIAAHRANIDLPFERGAAIDLAGRDV LEAVQMSVNPKVIETPFIAGIAMDGIEVKALARITVRANIDRLVGGAGEETIIARVGEGV VSTIGSSDHHKQVLENPDSISQTVLSKGLDSGTAFEILSIDIADVDIGKNIGAILQTDQA EADKNIAQAKAEERRAMAVAQEQEMVARVQEMRAKVVEAEADVPLALAEALRSGKMGVMD YMNYQNIDADTDMRDSIGKLSKENKDDDQQ
Uniprot No.

Target Background

Function

Recombinant Oceanobacillus iheyensis UPF0365 protein OB1959 (OB1959) is found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are considered significant contributors to membrane fluidity.

Database Links

KEGG: oih:OB1959

STRING: 221109.OB1959

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

How should recombinant OB1959 be optimally stored and handled for experimental consistency?

For optimal experimental reproducibility when working with recombinant OB1959, researchers should follow a specific storage and handling protocol. The protein should be stored at -20°C/-80°C upon receipt, with proper aliquoting to prevent repeated freeze-thaw cycles which can significantly reduce protein activity . When preparing working solutions, centrifuge the vial briefly before opening to bring contents to the bottom.

For reconstitution:

  • Use deionized sterile water to reconstitute to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Store working aliquots at 4°C for a maximum of one week

The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability . This methodological approach ensures minimal degradation between experiments, which is crucial for studying proteins from extremophiles that may have inherent structural adaptations.

What expression systems are most effective for producing functional recombinant OB1959?

The most successful expression system documented for OB1959 is E. coli with N-terminal His-tagging . This methodological choice addresses several experimental challenges:

  • E. coli provides high yield production while maintaining protein functionality

  • N-terminal His-tagging allows for efficient purification via affinity chromatography without interfering with potential C-terminal functional domains

  • The expressed protein maintains >90% purity as determined by SDS-PAGE analysis

When designing expression protocols, researchers should consider:

ParameterRecommended ConditionRationale
Host strainE. coli BL21(DE3)Reduced protease activity
Induction temperature16-18°CMinimizes inclusion body formation
IPTG concentration0.5-1.0 mMOptimal for controlled expression
Post-induction time16-18 hoursMaximizes yield while preventing degradation

This methodological approach increases the likelihood of obtaining properly folded, functional protein for downstream analyses, which is especially important for proteins from extremophiles where traditional expression conditions may not support proper folding.

What quasi-experimental designs are most appropriate for studying OB1959 function in comparative genomic contexts?

When investigating OB1959 function through comparative genomics, researchers should employ rigorous quasi-experimental designs that control for potential confounding variables. The untreated control group design with dependent pretest and posttest samples using a double pretest approach offers robust experimental control .

This design can be represented as:

Intervention group: O1a O2a X O3a
Control group: O1b O2b O3b

Where O represents observations (measurements) and X represents the intervention .

In the context of OB1959 functional studies, this could be implemented as:

  • First measure baseline expression levels of potential interacting partners (O1a, O1b)

  • Second measurement under standard conditions (O2a, O2b)

  • Introduction of recombinant OB1959 or OB1959 mutation (X)

  • Final measurement after intervention (O3a, O3b)

This quasi-experimental approach is particularly valuable when studying proteins like OB1959 that come from organisms with complex environmental adaptations, as it helps distinguish between correlation and causation in functional networks . The double pretest helps establish stability of the dependent variable before intervention, strengthening causal inferences about OB1959's role in cellular processes.

How does OB1959 contribute to the alkaliphilic and halotolerant adaptations of Oceanobacillus iheyensis?

OB1959's potential role in extremophilic adaptation can be investigated through a comprehensive functional genomics approach. Oceanobacillus iheyensis thrives in highly alkaline (pH optimum 7.5-10.0) and saline (growth in up to 21% NaCl) environments . Studying OB1959's contribution requires multi-level experimental approaches:

  • Comparative genomic analysis reveals OB1959 is part of the conserved gene set in alkaliphilic Bacillus species but with sequence variations in non-alkaliphilic relatives .

  • Genomic context analysis places OB1959 within the functional network of genes involved in:

    • Regulation of intracellular osmotic pressure

    • pH homeostasis mechanisms

    • Membrane integrity maintenance

  • Experimental knockout/complementation studies using interrupted time-series design:

TimepointMeasurementInterventionExpected Outcome
O1-O5Growth rate at different pH/saltBaseline measurementsEstablish normal growth patterns
XOB1959 knockout or overexpressionGenetic modificationChange in protein expression
O6-O10Growth rate at different pH/saltPost-intervention measurementsAltered tolerance to alkaline/salt conditions

This methodological framework allows researchers to determine whether OB1959 is directly involved in the extremophile adaptations that make O. iheyensis unique among Bacillus-related species . The interrupted time-series design provides stronger evidence for causal relationships than simple pre-post measures.

What are the methodological challenges in determining OB1959 interaction partners and how can they be addressed?

Determining protein-protein interactions for OB1959 presents several methodological challenges that require careful experimental design. Based on analysis of the OB1959 sequence and structural predictions, researchers should consider:

  • The membrane-associated nature of OB1959, suggested by its hydrophobicity profile and presence of transmembrane regions, necessitates specialized approaches .

  • Methodological approaches should incorporate multiple complementary techniques:

Interaction Detection MethodAdvantagesLimitationsMethodological Considerations
Yeast Two-Hybrid (Y2H)High-throughput screeningHigh false positive rate for membrane proteinsUse specialized membrane Y2H systems
Co-immunoprecipitationDetects interactions in near-native conditionsRequires suitable antibodiesUse anti-His tag antibodies with recombinant protein
Pull-down assaysCan detect transient interactionsMay not maintain native conformationTest multiple buffer conditions mimicking alkaline environments
Crosslinking Mass SpectrometryCaptures in vivo interactionsComplex data analysisOptimize crosslinking conditions for membrane-associated proteins
  • When analyzing potential interaction partners, researchers should focus on proteins involved in:

    • Osmotic regulation pathways in alkaliphilic conditions

    • Membrane structural integrity maintenance

    • pH homeostasis mechanisms

This multi-method approach addresses the inherent limitations of individual techniques when studying potentially membrane-associated proteins from extremophiles. Contradictory results between methods should be systematically investigated rather than dismissed, as they may reveal context-dependent interactions relevant to OB1959's function.

How can active learning approaches enhance experimental designs for OB1959 functional characterization?

Active learning methodologies can significantly improve experimental design efficiency when characterizing proteins like OB1959 with unknown functions. Rather than following standardized protocols, researchers should implement adaptive experimental frameworks:

  • Begin with problem-based learning (PBL) approach to identify key hypotheses about OB1959 function based on:

    • Genomic context within the O. iheyensis genome

    • Structural homology to characterized proteins

    • Predicted functional domains

  • Apply an iterative experimental design that incorporates feedback loops:

    • Initial broad screening experiments

    • Analysis of preliminary results

    • Refinement of hypothesis

    • Targeted follow-up experiments

This approach has shown a statistically significant improvement in research performance with an effect size of 0.28 for clinical applications , and can be adapted for molecular biology research.

  • Implement a quasi-experimental design with switching replications:
    Intervention group: O1a X O2a O3a
    Control group: O1b O2b X O3b

This design allows for validation of findings across multiple experimental conditions while controlling for time-dependent variables .

The active learning approach brings several advantages to OB1959 research:

  • Reduces resource waste on non-informative experiments

  • Accelerates functional discovery through targeted hypothesis refinement

  • Increases sensitivity to unexpected findings that may reveal novel functions

This methodological framework is particularly valuable for studying proteins from extremophiles, where standard functional prediction algorithms may be less reliable due to specialized adaptations.

What bioinformatic workflows are most effective for predicting OB1959 function based on comparative genomics?

To predict OB1959 function through bioinformatics, researchers should implement a multi-stage workflow that leverages the available genome sequence data from O. iheyensis and related Bacillus species. The genome of O. iheyensis consists of 3.6 Mb with OB1959 being one of the 1,803 putative proteins identified as orthologs through comparative analyses with other Bacillus-related species .

An effective methodological workflow includes:

  • Ortholog identification across multiple genomes:

    • OB1959 represents part of the core genome (~44.0-51.2%) shared between Bacillus-related species

    • About 980 orthologs are located at similar positions across genomes, with OB1959 showing syntenic conservation

  • Structural prediction and domain analysis:

    • Secondary structure prediction using multiple algorithms

    • Domain identification through InterProScan and CDD searches

    • Transmembrane region prediction with TMHMM and Phobius

  • Functional network construction based on genomic context:

    • Identification of conserved gene neighborhoods

    • Co-expression analysis across multiple conditions

    • Pathway enrichment analysis of predicted interaction partners

The physical distribution of common genes between O. iheyensis and B. halodurans is largely collinear, with direction changes at specific genome coordinates . This genomic context can provide crucial clues to OB1959 function by association with genes of known function.

How should researchers interpret contradictory experimental results when characterizing OB1959?

When faced with contradictory results in OB1959 characterization studies, researchers should implement a systematic resolution framework:

  • Examine experimental design limitations using quasi-experimental design analysis:

    • Identify potential threats to internal validity (history, maturation, testing, instrumentation, selection bias)

    • Evaluate external validity constraints that may limit generalizability

  • Implement a data triangulation approach:

    • Cross-validate findings using multiple methodologies

    • Compare results across different experimental conditions

    • Verify with orthogonal techniques that rely on different physical principles

  • Consider contextual factors specific to extremophile proteins:

    • Buffer composition effects on protein behavior

    • Temperature and pH sensitivity of interactions

    • Salt concentration influence on structural integrity

When analyzing contradictory results, researchers should construct a decision matrix:

Result TypePossible ExplanationValidation ApproachImplementation Strategy
False positiveNon-specific binding due to His-tagRepeat with alternative tags or tag-free proteinExpress protein with different purification strategies
False negativeSuboptimal buffer conditionsScreen multiple buffers mimicking native environmentUse alkaline buffers with varying salt concentrations
Inconsistent resultsTemperature-dependent conformational changesTest activity across temperature rangeInclude temperature controls in all experiments

This methodological framework transforms contradictory results from obstacles into valuable data points that may reveal regulatory mechanisms or context-dependent functions of OB1959, particularly important when studying proteins adapted to extreme environments.

What are the most promising future research directions for understanding OB1959 function?

Based on current knowledge, the most promising research directions for OB1959 involve integrated approaches that combine multiple experimental modalities. Researchers should prioritize:

  • Comprehensive functional genomics studies using the quasi-experimental design with switching replications approach to establish causality between OB1959 and specific cellular phenotypes in:

    • pH homeostasis mechanisms

    • Osmotic stress responses

    • Membrane integrity maintenance

  • Structural biology investigations to determine:

    • High-resolution structure through X-ray crystallography or cryo-EM

    • Conformational changes under varying pH and salt conditions

    • Binding sites for potential interaction partners

  • Systems biology approaches including:

    • Transcriptomic profiling in wildtype vs. OB1959 knockout strains

    • Metabolomic analysis to identify pathways affected by OB1959 function

    • Network modeling to position OB1959 within the cellular adaptation framework

The genome comparison with other major Gram-positive bacterial species suggests that OB1959 is part of a core set of approximately 350 genes that form the backbone of the genus Bacillus . Understanding OB1959's function will provide valuable insights into how extremophiles adapt to challenging environments, with potential applications in biotechnology and synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.