Recombinant Ochotona collaris NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Production and Expression

The recombinant protein is typically expressed in E. coli or yeast systems, with modifications such as N-terminal His-tagging for purification. Key production details include:

Production AspectDetailsSource
Host OrganismE. coli (common), yeast (partial)
TagHis-tag (N-terminal)
Purity>90% (SDS-PAGE)
Storage BufferTris-based buffer, 6% trehalose, pH 8.0
StabilityLyophilized powder; avoid repeated freeze-thaw cycles; store at -20°C/-80°C

Applications in Research

The recombinant protein is utilized in diverse experimental contexts:

ApplicationDetailsSource
ELISADetects MT-ND4L levels in biological samples; validated for Ochotona collaris
SDS-PAGEPurity assessment (>90% confirmed)
Metabolic StudiesExamines Complex I activity in oxidative phosphorylation
Structural BiologyCryo-EM studies of Complex I architecture (e.g., Bos taurus model)

Comparative Analysis with Other Species

MT-ND4L exhibits conserved structural features across species, though sequence variations exist. Below is a comparison of key characteristics:

SpeciesUniProt IDProtein LengthGene OverlapClinical RelevanceSource
Ochotona collarisQ953J998 aaN/ALimited data
Homo sapiensP0390198 aaOverlaps with MT-ND4LHON, metabolic disorders
Oryzomys albigularisO2155898 aaN/AModel for mitochondrial diseases
Bos taurusNot listed98 aaN/AStructural studies of Complex I

Challenges and Considerations

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Ochotona collaris (Collared pika)
Target Names
Target Protein Sequence
MSITTLNIMVAFTMALLGMFTYRSHLMSSLLCLEGMMLSLFMLATIVSLNMNFTISFMFP VILLVFAACEAAVGLALLVMVSNTYGMDYIHNLNLLQC
Uniprot No.

Target Background

Function
A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its role in mitochondrial function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a protein encoded by the mitochondrial genome that functions as a critical component of respiratory complex I (NADH dehydrogenase). This complex is embedded in the inner mitochondrial membrane and plays an essential role in oxidative phosphorylation.

Specifically, MT-ND4L contributes to the first step in the electron transport process, facilitating the transfer of electrons from NADH to ubiquinone. This electron transfer creates an electrochemical gradient across the inner mitochondrial membrane, which provides the energy required for ATP production . The protein is relatively small but crucial for maintaining the structural integrity and proper functioning of complex I.

What are recommended protocols for working with recombinant MT-ND4L in experimental settings?

When working with recombinant Ochotona collaris MT-ND4L, researchers should consider the following protocol recommendations:

Storage and Handling:

  • Store at -20°C for regular use, or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles; prepare working aliquots and store at 4°C for up to one week

  • Use Tris-based buffer with 50% glycerol for optimal protein stability

Experimental Considerations:

  • For activity assays, maintain pH between 7.2-7.5

  • Include appropriate detergents (e.g., 0.1% DDM) when working with this membrane protein

  • When reconstituting the protein, use artificial liposomes with lipid compositions mimicking the inner mitochondrial membrane

  • For complex I activity assays, monitor NADH oxidation spectrophotometrically at 340 nm

Western Blot Detection:

  • Use denaturing conditions with 12-15% SDS-PAGE gels

  • Transfer to PVDF membranes at lower voltages (15-20V) for longer periods (60-90 minutes)

  • Block with 5% non-fat milk or BSA in TBS-T for 1-2 hours

How can researchers verify the functional activity of recombinant MT-ND4L?

Verifying functional activity of recombinant MT-ND4L requires multiple approaches:

Complex I Activity Reconstitution:

  • Incorporate purified recombinant MT-ND4L into liposomes containing other complex I subunits

  • Measure NADH:ubiquinone oxidoreductase activity using ubiquinone analogs (e.g., CoQ1)

  • Compare activity with and without the recombinant protein to determine its contribution

Structural Integrity Assessment:

  • Perform circular dichroism (CD) spectroscopy to verify proper secondary structure

  • Use size-exclusion chromatography to confirm appropriate oligomeric states

  • Employ native gel electrophoresis to assess complex formation with other subunits

Binding Assays:

  • Conduct pull-down assays with other complex I subunits

  • Use surface plasmon resonance (SPR) to quantify binding affinities

  • Perform co-immunoprecipitation with antibodies against other complex I components

A decrease in activity upon introduction of specific mutations known to affect function can serve as an additional control for functional verification.

How is MT-ND4L associated with neurodegenerative diseases?

MT-ND4L has been implicated in several neurodegenerative conditions through both genetic and functional studies:

Alzheimer's Disease Association:
Recent whole exome sequencing analysis from the Alzheimer's Disease Sequencing Project (ADSP) involving 10,831 participants identified a significant association between AD risk and a rare MT-ND4L variant (rs28709356 C>T). This variant had a minor allele frequency of 0.002 and showed a study-wide significant association (P = 7.3 × 10^-5). Gene-based testing further confirmed the association of MT-ND4L with AD (P = 6.71 × 10^-5) .

Leber Hereditary Optic Neuropathy:
A mutation in MT-ND4L (T10663C or Val65Ala) has been identified in several families with Leber hereditary optic neuropathy. This mutation changes a valine to alanine at position 65, though the precise mechanism leading to vision loss remains under investigation .

Research Approaches:

  • Implement comprehensive mitochondrial DNA sequencing in disease cohorts

  • Develop cellular models expressing MT-ND4L variants to assess impact on complex I function

  • Measure ATP production, ROS generation, and membrane potential in cells expressing mutant variants

  • Use animal models to study the systemic effects of MT-ND4L mutations

What methodological approaches are recommended for studying MT-ND4L mutations in cancer research?

Cancer research, particularly in triple-negative breast cancer (TNBC), has revealed important roles for MT-ND4L mutations:

Detection Methods for MT-ND4L Mutations:

  • Deep sequencing of mitochondrial genomes (>1000× coverage recommended)

  • Real-time quantitative PCR for MT-ND4L/nuclear DNA ratio determination

  • Analysis of minor allele frequencies (MAF) between tumor and matched normal tissues

  • Circulating extracellular vesicle (EV) analysis for detection of mtDNA mutations

Research Protocol for MT-ND4L Cancer Studies:

  • Sequence matched normal and tumor tissues (minimum 30 pairs recommended)

  • Calculate mutation frequencies and determine homoplasmic versus heteroplasmic status

  • Correlate mutations with clinical parameters (e.g., metastasis, survival)

  • Implement functional studies in cancer cell lines with MT-ND4L mutations

Research in TNBC has shown that respiratory complex I (RCI) appears to be a mutational hotspot, with MT-ND4L accounting for approximately 12% (9 out of 74) of all RCI mutations detected . These findings suggest MT-ND4L plays a significant role in the metabolic reprogramming observed in cancer.

How does MT-ND4L vary across Ochotona species and what are the evolutionary implications?

The evolutionary study of MT-ND4L across Ochotona species provides valuable insights into mitochondrial adaptation and species divergence:

Interspecies Variation:
The genus Ochotona comprises approximately 30 currently recognized species, with significant divergence in mitochondrial genes, including MT-ND4L. Genomic studies have identified:

  • Mitonuclear discordance in several species pairs

  • Evidence of introgression events affecting mitochondrial gene flow

  • Different selective pressures on MT-ND4L across species inhabiting varied elevations and climates

Evolutionary Timeline and Events:
Analysis of mitochondrial genomes across Ochotona species reveals:

  • Gene flow patterns from O. nubrica to O. curzoniae

  • Introgression from O. cansus to O. nubrica

  • Significant introgression signals between most species pairs with 15 of 20 comparisons producing Z scores >3

Research Applications:

  • Comparative analysis of MT-ND4L sequences across species using phylogenetic methods

  • Assessment of selection pressure using dN/dS ratios

  • Reconstruction of ancestral sequences to understand evolutionary trajectories

  • Correlation of sequence variations with ecological adaptations and metabolic requirements

This evolutionary perspective is particularly valuable for understanding how mitochondrial proteins adapt to different environmental conditions, especially for species like Ochotona that inhabit varied elevations and temperature regimes.

What techniques are recommended for studying MT-ND4L in an evolutionary context?

To effectively study MT-ND4L in an evolutionary context, researchers should consider:

Sequencing and Phylogenetic Analysis:

  • Whole mitochondrial genome sequencing (>1000× coverage)

  • Careful differentiation between authentic mtDNA and nuclear insertions of mitochondrial DNA (NUMTs)

  • Phylogenetic reconstruction using maximum likelihood or Bayesian methods

  • ABBA-BABA statistics to test for introgression

Functional Evolutionary Studies:

  • Express MT-ND4L variants from different species in model systems

  • Measure complex I activity across temperature gradients to assess thermal adaptation

  • Construct chimeric proteins to identify regions responsible for functional differences

  • Use site-directed mutagenesis to recreate ancestral states

Bioinformatic Approaches:

  • Apply tests for positive selection using PAML or similar software

  • Use protein modeling to predict structural consequences of amino acid substitutions

  • Compare conservation patterns across mammalian lineages

  • Implement tests for convergent evolution in species adapting to similar environments

A comprehensive approach combining these methods can provide insights into how MT-ND4L has evolved to maintain mitochondrial function across different ecological niches occupied by Ochotona species.

What are the challenges in expressing and purifying functional MT-ND4L?

Expressing and purifying functional MT-ND4L presents several unique challenges that researchers should address:

Expression Challenges:

  • Hydrophobic nature of MT-ND4L makes expression in standard bacterial systems difficult

  • Proper folding often requires the presence of other complex I subunits

  • Mitochondrial genetic code differences can lead to mistranslation in bacterial systems

  • Toxicity to host cells when overexpressed

Purification Challenges:

  • Requires specialized detergents to maintain solubility while preserving structure

  • Tendency to aggregate when removed from membrane environment

  • Difficulty in obtaining high yields due to expression limitations

  • Need for specialized chromatography methods for membrane proteins

Recommended Approaches:

  • Use specialized expression systems like C41(DE3) or C43(DE3) bacterial strains

  • Consider cell-free expression systems with supplemented lipids

  • Implement mild detergents like DDM, LMNG, or amphipols

  • Consider co-expression with chaperones or fusion tags to improve solubility

  • Utilize nanodiscs or liposomes for maintaining native-like environment post-purification

Successful expression typically requires optimization of codon usage, temperature, inducer concentration, and host strain selection. A tag-based purification strategy using polyhistidine or Strep-tag II, followed by size exclusion chromatography, has shown promise for obtaining pure, functional protein.

How can researchers design experiments to study the impact of MT-ND4L mutations on mitochondrial complex I function?

Designing rigorous experiments to study MT-ND4L mutations requires careful consideration of multiple parameters:

In Vitro Systems:

  • Reconstitute complex I with wild-type or mutant MT-ND4L

  • Measure electron transfer rates from NADH to ubiquinone using spectrophotometric assays

  • Assess proton pumping efficiency using pH-sensitive fluorescent probes

  • Determine structural integrity of complex I using blue native PAGE or cryo-EM

Cellular Models:

  • Generate cell lines with MT-ND4L mutations using cybrid technology

  • Create CRISPR-based mitochondrial DNA editing systems for precise mutation introduction

  • Measure oxygen consumption rates using high-resolution respirometry

  • Assess mitochondrial membrane potential using potentiometric dyes

Experimental Design Considerations:

ParameterWild-type MT-ND4LMutant MT-ND4LAnalysis Method
NADH oxidation rateBaseline value% of wild-typeSpectrophotometric assay (340 nm)
Superoxide productionBaseline value% of wild-typeMitoSOX fluorescence
ATP synthesisBaseline value% of wild-typeLuciferase-based assays
Complex I assemblyComplete assemblyAssembly defectsBlue native PAGE
Mitochondrial membrane potentialNormalAlteredTMRM or JC-1 fluorescence

When designing these experiments, researchers should include appropriate controls, such as a rescue experiment where wild-type MT-ND4L is reintroduced, and consider the impact of heteroplasmy levels on the observed phenotypes.

How can researchers utilize MT-ND4L as a biomarker in clinical studies?

The potential of MT-ND4L as a biomarker in various clinical contexts is emerging as an important research direction:

Detection in Clinical Samples:

  • Mutations in MT-ND4L can be detected in circulating extracellular vesicles (EVs), providing a non-invasive liquid biopsy approach

  • Deep sequencing of MT-ND4L from EVs shows correlation with tissue-based mutation detection

  • Minor allele frequency analysis can distinguish cancer-specific mutations from polymorphisms

Biomarker Applications:

  • Neurodegenerative disease risk assessment (particularly for the rs28709356 C>T variant in Alzheimer's)

  • Cancer progression monitoring through serial liquid biopsies

  • Treatment response prediction based on mitochondrial function markers

  • Pharmacogenomic applications for drugs targeting metabolic pathways

Methodological Considerations:

  • Implement droplet digital PCR for sensitive detection of low-frequency mutations

  • Utilize next-generation sequencing with molecular barcoding for accurate quantification

  • Develop assays capable of detecting heteroplasmy at levels as low as 1%

  • Include controls for nuclear pseudogene amplification to prevent false positives

Research has shown that MT-ND4L mutations detected in circulating EVs can provide additional diagnostic information beyond tissue biopsies alone, with one study identifying 11 MT-ND4L mutations exclusively in EVs that were not detected in matched tissue samples .

What are the cutting-edge techniques for studying MT-ND4L structure-function relationships?

Advanced structural and functional analysis of MT-ND4L is now possible through several cutting-edge techniques:

Cryo-Electron Microscopy:

  • Recent advances allow near-atomic resolution of membrane protein complexes

  • Can visualize MT-ND4L in the context of intact complex I

  • Enables mapping of mutation effects on protein-protein interactions

  • Facilitates structure-based drug design targeting specific regions

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Provides information on protein dynamics and conformational changes

  • Can identify regions with altered flexibility due to mutations

  • Useful for studying interaction interfaces with other complex I subunits

Single-Molecule FRET:

  • Allows real-time observation of conformational changes during catalysis

  • Can detect subtle structural alterations caused by disease-associated mutations

  • Enables correlation between structural dynamics and functional output

Nanoscale Optical Recording:

  • Permits visualization of complex I function in live cells

  • Can track the effects of MT-ND4L mutations on localized proton pumping

  • Allows correlation between structure and function at the single-molecule level

These advanced techniques, when combined with computational approaches like molecular dynamics simulations, provide unprecedented insights into how MT-ND4L mutations affect complex I function and contribute to disease pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.