Recombinant Ochotona princeps NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Ochotona princeps NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a recombinant protein derived from the mitochondrial genome of Ochotona princeps (southern American pika). It corresponds to a subunit of Complex I (NADH dehydrogenase) in the electron transport chain, critical for mitochondrial ATP production . This recombinant version is engineered for research applications, including ELISA assays, functional studies, and structural analysis .

Functional Role in Mitochondrial Energy Metabolism

MT-ND4L is a core subunit of Complex I, facilitating:

  • Electron Transfer: Transfers electrons from NADH to ubiquinone (CoQ10), generating a proton gradient across the mitochondrial inner membrane .

  • Proton Pumping: Conformational changes during electron transfer drive H⁺ extrusion, contributing to ATP synthesis via oxidative phosphorylation .

  • Structural Stability: Forms hydrophobic transmembrane domains critical for Complex I assembly .

While Ochotona princeps MT-ND4L shares functional homology with human and other species’ variants, species-specific differences in expression or activity have not been characterized .

ELISA Assays

Recombinant Ochotona princeps MT-ND4L is used in enzyme-linked immunosorbent assays (ELISA) to detect anti-MT-ND4L antibodies or study protein-protein interactions .

ParameterSpecification
Target ProteinFull-length MT-ND4L (1–98 aa)
AntigenRecombinant Ochotona princeps MT-ND4L
ApplicationsImmunoassays, antibody validation, research

Functional Studies

The recombinant protein is employed to:

  • Reconstitute Complex I Activity: In vitro assays to study electron transfer efficiency or ubiquinone binding .

  • Structural Analysis: X-ray crystallography or cryo-EM to resolve subunit interactions within Complex I .

Expression Systems

  • Bacterial: E. coli (His-tagged) .

  • Yeast: Used for partial-length or modified variants .

Clinical and Biological Significance

While Ochotona princeps MT-ND4L has no documented clinical associations, human MT-ND4L mutations are linked to:

  • Metabolic Disorders: Obesity, diabetes, hypertension .

  • Leber’s Hereditary Optic Neuropathy (LHON): A T>C mutation (Val65Ala) disrupts Complex I function, impairing ATP production .

No analogous studies exist for the Ochotona princeps variant, highlighting opportunities for comparative research.

Challenges and Future Directions

  • Limited Data: Most studies focus on human or model organisms (e.g., Gallus gallus), leaving Ochotona princeps MT-ND4L understudied .

  • Species-Specific Variations: Potential differences in Complex I assembly or substrate affinity warrant investigation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: Our proteins are standardly shipped with regular blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Ochotona princeps (Southern American pika)
Target Names
Target Protein Sequence
MSITTLNIMVAFMMALLGMFVYRSHLMSSLLCLEGMMLSLFMLATIVSLNMNFTISFMFP VILLVFAACEAAVGLALLIMVSNTYGMDYIHNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its functional role in mitochondrial respiration?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a small, integral membrane protein component of mitochondrial Complex I (NADH:ubiquinone oxidoreductase). This protein is encoded by the mitochondrial genome and plays a critical role in the electron transport chain. The MT-ND4L subunit contains highly conserved acidic residues embedded within transmembrane helices that are essential for ubiquinone reduction activity.

In Ochotona princeps (Southern American pika), MT-ND4L consists of 98 amino acids and functions as part of the membrane domain of Complex I. This protein contributes to proton pumping across the inner mitochondrial membrane, thereby helping establish the proton gradient necessary for ATP synthesis. The enzyme catalyzes electron transfer from NADH to ubiquinone with an EC number of 1.6.5.3 .

What are the key structural characteristics of Ochotona princeps MT-ND4L?

Ochotona princeps MT-ND4L is a small hydrophobic protein with several distinct structural features:

  • Amino Acid Sequence: The full sequence is "MSITTLNIMVAFMMALLGMFVYRSHLMSSLLCLEGMMLSLFMLATIVSLNMNFTISFMFPVILLVFAACEAAVGLALLIMSNTYGMDYIHNLNLLQC" .

  • Transmembrane Topology: The protein contains multiple transmembrane helices that span the inner mitochondrial membrane.

  • Conserved Acidic Residues: Similar to related proteins in other species, MT-ND4L contains critical acidic residues (likely glutamates) embedded within its transmembrane domains that are essential for electron transfer and ubiquinone binding/reduction .

  • Size: The expression region spans amino acids 1-98, making it one of the smallest subunits of Complex I .

  • UniProt Accession: Q70UT9 .

This protein is highly hydrophobic due to its membrane-embedded nature, containing multiple transmembrane segments rich in hydrophobic amino acids like leucine, isoleucine, and phenylalanine.

How can researchers effectively produce and purify recombinant MT-ND4L for experimental studies?

Producing recombinant MT-ND4L presents significant challenges due to its highly hydrophobic nature and membrane integration. Researchers should consider the following methodological approach:

  • Expression System Selection:

    • Bacterial systems (E. coli): Can be used with fusion tags to enhance solubility

    • Yeast systems (S. cerevisiae or P. pastoris): Better for membrane proteins due to eukaryotic processing machinery

    • Cell-free expression systems: Useful for toxic or difficult-to-express membrane proteins

  • Optimization Strategies:

    • Use specialized E. coli strains designed for membrane protein expression (C41/C43)

    • Express as a fusion with solubility-enhancing tags (MBP, SUMO, or Thioredoxin)

    • Lower expression temperature (16-20°C) to allow proper folding

  • Purification Approach:

    • Solubilize using mild detergents (DDM, LDAO, or digitonin)

    • Purify using affinity chromatography via His-tag or other fusion tags

    • Consider size exclusion chromatography for final polishing

  • Quality Control:

    • Verify proper folding using circular dichroism spectroscopy

    • Assess purity using SDS-PAGE and Western blotting

    • Confirm identity using mass spectrometry

Similar approaches have been successfully used for other Complex I subunits, including NDH-2 from S. cerevisiae, where Triton X-100 and DM were effective detergents for extraction .

How can researchers effectively investigate the ubiquinone binding site in MT-ND4L and related proteins?

Investigating the ubiquinone binding site in MT-ND4L requires sophisticated biochemical and biophysical approaches. Based on studies of related proteins, the following methodological strategies are recommended:

  • Photoaffinity Labeling Strategy:

    • Synthesize photoreactive biotinylated ubiquinone analogs with minimal modification to the quinone ring structure

    • The ideal probe should include a photoreactive azido group and a biotin tag for detection

    • Include at least two isoprenyl groups directly attached to the Q-ring to ensure natural binding characteristics

    • Perform UV crosslinking followed by proteomic analysis to identify binding sites

  • Site-Directed Mutagenesis Analysis:

    • Target conserved acidic residues within transmembrane domains

    • Create systematic mutations (e.g., Glu→Asp or Glu→Gln) to assess the importance of negative charge and side chain length

    • Evaluate effects on both electron transfer activity and proton pumping capacity

    • Particularly focus on acidic residues within transmembrane helices that are separated by approximately one helical turn (3-4 amino acids)

  • Structural Analysis Protocol:

    • Use computational modeling based on homologous proteins to predict binding sites

    • Employ molecular dynamics simulations to study ubiquinone-protein interactions

    • If possible, attempt crystallization with bound ubiquinone analogs

  • Functional Verification:

    • Measure ubiquinone reductase activity using spectrophotometric assays (340 nm to monitor NADH oxidation)

    • Compare activities with different ubiquinone analogs to define structure-activity relationships

A typical experimental workflow might include:

  • Expression of recombinant protein

  • Reconstitution with synthetic ubiquinone analogs

  • Photoaffinity labeling

  • Enrichment of labeled protein using streptavidin-agarose

  • Proteomic analysis to identify the specific binding regions

What are the implications of MT-ND4L variants in neurodegenerative diseases and how can researchers study them?

Recent evidence suggests significant associations between MT-ND4L variants and Alzheimer's disease (AD) . This connection warrants thorough investigation using the following research approaches:

  • Genetic Association Analysis:

    • Perform mitochondrial DNA sequencing in case-control studies

    • Analyze haplogroup distributions in patient populations

    • Conduct meta-analyses of existing genetic data

    • Use next-generation sequencing for comprehensive mitochondrial variant identification

  • Functional Characterization Methodology:

    • Express disease-associated variants in cellular models

    • Measure Complex I activity, ROS production, and ATP synthesis

    • Assess mitochondrial membrane potential in cells expressing variants

    • Evaluate oxygen consumption rates using Seahorse technology

  • Cybrid Cell Models:

    • Create transmitochondrial cybrids by fusing platelets from patients with rho-zero cells

    • Compare biochemical parameters between cybrids with different MT-ND4L variants

    • Assess cellular responses to metabolic stress and oxidative challenges

  • Neuronal Model Systems:

    • Generate induced pluripotent stem cells (iPSCs) from patients with specific variants

    • Differentiate into neurons and assess mitochondrial function

    • Measure neurite outgrowth, synaptic density, and electrophysiological parameters

    • Evaluate responses to amyloid-beta and tau pathology

  • Data Integration Framework:

    • Correlate biochemical findings with clinical phenotypes

    • Use machine learning approaches to identify patterns in complex datasets

    • Develop predictive models for disease progression based on mitochondrial variants

The association between MT-ND4L variants and Alzheimer's disease suggests impaired mitochondrial function may contribute to neurodegeneration through multiple mechanisms including energy deficiency, increased oxidative stress, and altered calcium homeostasis.

How do the conserved acidic residues in MT-ND4L contribute to Complex I function?

Conserved acidic residues within the transmembrane domains of MT-ND4L play crucial roles in Complex I function. Based on studies of homologous proteins, these residues are essential for ubiquinone reduction and potentially for proton translocation. Research approaches to investigate their functions include:

  • Systematic Mutagenesis Strategy:

    • Create point mutations of conserved glutamate residues to aspartate (conserves negative charge) or glutamine (neutralizes charge)

    • Generate double mutants to assess cooperative effects

    • Create positional mutants by shifting acidic residues along helices to assess spatial requirements

  • Functional Assessment Protocol:

    • Measure NADH:ubiquinone oxidoreductase activity using spectrophotometric assays

    • Assess proton pumping efficiency in reconstituted proteoliposomes

    • Determine kinetic parameters (Km, Vmax) for various ubiquinone analogs

    • Evaluate growth phenotypes in complementation systems

  • Key Experimental Findings from Related Research:

    • In related systems, two closely located membrane-embedded acidic residues are essential for high rates of ubiquinone reduction

    • These residues do not necessarily need to be on adjacent helices

    • Optimal placement appears to be at intervals of three amino acids (approximately one turn of the α-helix) on the same helix

    • Shifting acidic residues toward the periplasmic side severely impairs activity

    • Moving both acidic residues together can sometimes stimulate ubiquinone reductase activity but may compromise energy conservation

The precise mechanism likely involves:

  • Direct interaction with ubiquinone or ubiquinol

  • Formation of a charged microenvironment that facilitates electron transfer

  • Potential involvement in proton uptake or release

  • Structural stabilization of the quinone-binding pocket

These findings highlight the critical importance of both the presence and precise positioning of acidic residues within the transmembrane domains of Complex I subunits.

What techniques are most effective for studying the interaction between MT-ND4L and other Complex I subunits?

Investigating subunit interactions within Complex I requires specialized techniques given the complex's large size and membrane-embedded nature. Researchers should consider these methodological approaches:

  • Crosslinking-Mass Spectrometry Protocol:

    • Use chemical crosslinkers with various spacer lengths (EDC, DSS, BS3)

    • Perform in situ crosslinking in intact mitochondria or with purified Complex I

    • Digest crosslinked samples with multiple proteases to ensure comprehensive coverage

    • Analyze using LC-MS/MS with specialized software for crosslinked peptide identification

    • Validate interactions using targeted mutagenesis of interface residues

  • Cryo-EM Analysis Strategy:

    • Purify intact Complex I using mild detergents or amphipols

    • Perform single-particle cryo-EM analysis at high resolution

    • Generate 3D reconstructions to visualize subunit interfaces

    • Compare structures with and without substrates or inhibitors

    • Use molecular dynamics flexible fitting to interpret lower-resolution regions

  • Genetic Complementation Approach:

    • Create knockout or knockdown models of MT-ND4L

    • Complement with wild-type or mutated versions

    • Assess assembly of Complex I using Blue Native PAGE

    • Evaluate functional rescue using activity assays

    • Screen for second-site suppressors that restore interaction

  • Co-Immunoprecipitation Methodology:

    • Use epitope-tagged versions of MT-ND4L

    • Perform mild solubilization to maintain protein-protein interactions

    • Capture using antibodies against the tag or against other Complex I subunits

    • Identify interacting partners by Western blotting or mass spectrometry

    • Compare interaction patterns with wild-type versus mutant forms

  • Hydrogen-Deuterium Exchange Mass Spectrometry:

    • Map regions of MT-ND4L that show protection from exchange when assembled in Complex I

    • Identify dynamic regions that may undergo conformational changes during catalysis

    • Compare exchange patterns in the presence of substrates, inhibitors, or mutations

These approaches provide complementary information about the structural and functional relationships between MT-ND4L and other Complex I components, offering insights into assembly, stability, and the mechanisms of electron transfer and proton pumping.

What are the optimal conditions for assessing MT-ND4L function in vitro?

Establishing optimal conditions for MT-ND4L functional assessment requires careful consideration of multiple biochemical parameters. Based on protocols for related proteins, researchers should consider:

  • Enzyme Preparation Protocol:

    • Purify using mild detergents (Triton X-100 for ubiquinone-free preparations or DM for ubiquinone-bound forms)

    • Maintain protein concentration between 0.1-0.3 mg/mL for functional assays

    • Store in buffer containing 50 mM MOPS-KOH (pH 7.0), 0.1 mM EDTA, and 10% glycerol

  • Activity Assay Optimization:

    • Reaction medium: 50 mM sodium phosphate buffer (pH 6.0) with 1 mM EDTA

    • Protein concentration: ~0.066 μg/mL for spectrophotometric assays

    • NADH concentration: 100 μM

    • Monitor NADH oxidation at 340 nm (ε = 6.2 mM⁻¹cm⁻¹)

  • Ubiquinone Substrate Selection:

    • Test multiple ubiquinone analogs with varying side chain lengths (UQ₁, UQ₂, UQ₆)

    • Consider synthetic analogs with defined structures for mechanistic studies

    • Pre-equilibrate enzyme with ubiquinone before initiating reaction with NADH

  • Data Analysis Framework:

    • Calculate initial reaction rates from the linear portion of progress curves

    • Determine kinetic parameters (Km, Vmax) using non-linear regression

    • Compare activity with different substrates using relative activity ratios

    • Use appropriate controls (enzyme-free, substrate-free) for background correction

  • Troubleshooting Considerations:

    • Low activity may result from detergent-induced denaturation

    • Optimize detergent concentration to maintain both solubility and activity

    • Consider reconstitution into proteoliposomes for more native-like environment

    • Test activity in the presence of various lipids to identify activating components

How can researchers differentiate between the roles of MT-ND4L and other Complex I subunits in disease models?

Differentiating the specific contributions of MT-ND4L from other Complex I subunits in disease pathogenesis requires sophisticated experimental designs:

  • Selective Gene Manipulation Strategy:

    • Use mitochondrially targeted nucleases (mitoTALENs, mitoCRISPR) to specifically edit MT-ND4L

    • Create cybrid cell lines with defined mitochondrial DNA mutations

    • Develop transgenic animal models expressing variant forms of MT-ND4L

    • Use RNA interference for nuclear-encoded subunits as comparison controls

  • Biochemical Analysis Protocol:

    • Perform Blue Native PAGE to assess Complex I assembly states

    • Measure individual electron transfer steps using specific donor/acceptor pairs

    • Compare proton pumping efficiency in isolated mitochondria

    • Use specific inhibitors to dissect electron transfer versus proton pumping defects

  • Structural Biology Approach:

    • Generate molecular models of mutant MT-ND4L in the context of intact Complex I

    • Identify structural perturbations that affect interaction with adjacent subunits

    • Assess changes in ubiquinone binding pocket geometry

    • Predict functional consequences using molecular dynamics simulations

  • Translational Research Framework:

    • Analyze patient samples for specific biomarkers associated with MT-ND4L dysfunction

    • Correlate clinical phenotypes with specific biochemical defects

    • Develop targeted therapeutic approaches based on mechanism

    • Test pharmacological bypasses of defective steps in the electron transport chain

  • Comparative Analysis Methodology:

    • Create equivalent mutations in different subunits and compare phenotypes

    • Assess compensatory mechanisms that may mask subunit-specific defects

    • Evaluate subunit-specific responses to environmental stressors

    • Determine tissue-specific consequences of equivalent mutations

This multifaceted approach enables researchers to attribute specific pathological mechanisms to MT-ND4L dysfunction versus more general Complex I deficiency, providing insights for targeted therapeutic development.

What is the evidence linking MT-ND4L variants to Alzheimer's disease and other neurodegenerative conditions?

Recent studies have identified significant associations between MT-ND4L genetic variants and Alzheimer's disease (AD) . The evidence encompasses:

  • Genetic Association Data:

    • Study-wide significant associations have been identified between AD and MT-ND4L

    • Specific mitochondrial haplogroups containing MT-ND4L variants show altered disease risk

    • Next-generation sequencing approaches have revealed both common and rare variants

  • Functional Impact Evidence:

    • MT-ND4L variants affect Complex I assembly and activity

    • Decreased NADH:ubiquinone oxidoreductase activity correlates with specific variants

    • Altered reactive oxygen species production has been documented in cellular models

    • Energy deficiency may contribute to neuronal vulnerability

  • Pathological Connections:

    • Mitochondrial dysfunction appears early in AD pathogenesis

    • Complex I deficiency precedes amyloid-beta deposition in some models

    • MT-ND4L variants may affect mitochondrial dynamics and quality control

    • Synergistic effects with nuclear genetic risk factors have been observed

  • Translational Implications:

    • MT-ND4L genotyping may provide biomarkers for disease risk or progression

    • Targeting mitochondrial function represents a potential therapeutic approach

    • Personalized medicine strategies based on mitochondrial genomics are emerging

    • Early intervention in high-risk individuals with specific variants may delay onset

This growing body of evidence suggests that MT-ND4L plays a previously underappreciated role in neurodegenerative disease pathogenesis, potentially through mechanisms involving energy deficiency, oxidative stress, and altered cellular homeostasis.

How do membrane-embedded acidic residues in MT-ND4L contribute to ubiquinone reduction?

The mechanism by which membrane-embedded acidic residues in MT-ND4L and related proteins facilitate ubiquinone reduction involves sophisticated structural and electrochemical principles:

  • Mechanistic Model Based on Experimental Evidence:

    • Two closely located membrane-embedded acidic residues (glutamates) are essential for high rates of ubiquinone reduction

    • The optimal positioning appears to be at intervals of three amino acids (one helical turn) on the same transmembrane helix

    • The precise spatial arrangement is critical, as shifting one acidic residue toward the periplasmic side severely impairs activity

  • Proposed Functional Roles:

    • Direct interaction with ubiquinone through hydrogen bonding

    • Creation of a negative electrostatic environment to stabilize semiquinone intermediates

    • Participation in proton delivery to the quinone binding site

    • Structural organization of the quinone binding pocket

  • Structure-Function Relationships:

    • The acidic residues do not necessarily need to be on adjacent helices

    • Both the presence and precise positioning of the acidic residues are critical

    • Moving both acidic residues together can sometimes stimulate ubiquinone reductase activity but may compromise energy conservation

    • The relationship between ubiquinone reduction and proton pumping efficiency suggests these processes are tightly coupled

  • Experimental Support:

    • Mutational studies where glutamates are replaced with aspartates (conserving charge) or glutamines (neutralizing charge) demonstrate the importance of negative charge

    • Activity assays with various ubiquinone analogs reveal specific structural requirements for efficient reduction

    • Growth phenotypes in complementation systems correlate with biochemical measurements

These findings highlight the critical role of precisely positioned acidic residues in facilitating electron transfer to ubiquinone, a fundamental process in cellular energy production.

What emerging technologies show promise for studying MT-ND4L structure and function?

Several cutting-edge technologies are poised to advance our understanding of MT-ND4L structure and function:

  • Advanced Structural Biology Approaches:

    • Cryo-electron tomography of intact mitochondria to visualize Complex I in its native membrane environment

    • Microcrystal electron diffraction (MicroED) for membrane protein structural analysis

    • Integrative structural biology combining multiple data sources (cryo-EM, crosslinking-MS, molecular dynamics)

    • Time-resolved structural methods to capture conformational changes during catalysis

  • Single-Molecule Techniques:

    • FRET-based approaches to monitor conformational changes during electron transfer

    • Nanodiscs combined with single-molecule spectroscopy for functional studies

    • High-speed atomic force microscopy to visualize dynamics of Complex I

    • Single-molecule electrophysiology to measure proton translocation events

  • Advanced Genetic Tools:

    • Mitochondrially targeted CRISPR systems for precise engineering of MT-ND4L

    • Base editing and prime editing technologies for introducing specific mutations

    • Tissue-specific and inducible mitochondrial gene editing in animal models

    • Synthetic biology approaches to create minimal viable respiratory chains

  • Computational Advances:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations of electron transfer

    • Machine learning applications for predicting variant effects on function

    • Network analysis of mitochondrial-nuclear genetic interactions

    • In silico drug screening targeting MT-ND4L interfaces or binding sites

  • Translational Technologies:

    • Patient-derived organoids for personalized disease modeling

    • High-throughput screening platforms for identifying compounds that rescue MT-ND4L variants

    • Mitochondrially targeted therapeutic delivery systems

    • Multi-omics approaches to comprehensively characterize MT-ND4L variant effects

These emerging technologies promise to provide unprecedented insights into the structure, function, and disease associations of MT-ND4L, potentially leading to novel therapeutic strategies for mitochondrial dysfunction in neurodegenerative diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.