Recombinant Ochrobactrum anthropi ATP synthase subunit a 1 (atpB1)

Shipped with Ice Packs
In Stock

Description

ATP Synthase in Ochrobactrum anthropi

ATP synthase is a critical enzyme for cellular energy production, catalyzing ATP synthesis via oxidative phosphorylation. In O. anthropi, this enzyme comprises multiple subunits, including membrane-bound a subunits (part of the F₀ region) and peripheral b subunits (part of the F₁ region). Genomic studies reveal that O. anthropi ATCC 49188 possesses two chromosomes and four plasmids, with metabolic genes distributed across these replicons .

Subunit b 1 (atpF1)

  • Product Overview: Recombinant full-length O. anthropi ATP synthase subunit b 1 (UniProt ID: A6WW79, 1–205 amino acids) is expressed in E. coli with an N-terminal His tag .

  • Structural Features:

    • Molecular weight: ~23 kDa (predicted).

    • Function: Integral to proton translocation and F₁-F₀ coupling.

ParameterDetails
Expression HostEscherichia coli
TagN-terminal His tag
Purity>90% by SDS-PAGE
ApplicationsEnzyme assays, structural studies

Subunit a 2 (atpB2)

  • Product Overview: Recombinant subunit a 2 (UniProt ID: A6X1X3, 1–249 amino acids) is similarly expressed in E. coli with a His tag .

  • Role in ATP Synthase: Forms part of the F₀ proton channel.

ParameterDetails
Expression HostEscherichia coli
TagN-terminal His tag
Purity>90% by SDS-PAGE

Research Findings

  • Proteomic Insights: A temporal proteomic study identified ATP synthase subunits as dynamically expressed during O. anthropi growth phases. Subunits associated with glycolysis, TCA cycle, and oxidative phosphorylation were upregulated in late-phase growth, suggesting metabolic adaptations under nutrient depletion .

  • Genomic Context: The atp operon in O. anthropi includes genes encoding subunits critical for ATP synthesis, though their regulation remains understudied .

  • Biochemical Applications: Recombinant subunits are used to study enzyme assembly, inhibitor binding, and proton transport mechanisms.

Antimicrobial Resistance and Clinical Relevance

O. anthropi exhibits intrinsic resistance to β-lactams (e.g., penicillins, cephalosporins) due to inducible AmpC β-lactamases but remains susceptible to aminoglycosides, fluoroquinolones, and carbapenems . ATP synthase inhibitors could theoretically disrupt bacterial energetics, though no direct studies on O. anthropi ATP synthase targeting have been reported.

Comparative Analysis with Related Proteins

FeatureO. anthropi Subunit b 1 (atpF1)O. anthropi Subunit a 2 (atpB2)
LocalizationF₁ region (peripheral)F₀ region (membrane-embedded)
FunctionStructural stabilizationProton translocation
Recombinant UseEnzyme kinetics studiesMembrane protein reconstitution

Future Directions

  • Structural Biology: Cryo-EM studies of recombinant ATP synthase complexes could elucidate mechanisms of proton coupling.

  • Drug Discovery: Targeting ATP synthase subunits might offer novel antimicrobial strategies against multidrug-resistant O. anthropi infections.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB1; Oant_0500; ATP synthase subunit a 1; ATP synthase F0 sector subunit a 1; F-ATPase subunit 6 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)
Target Names
atpB1
Target Protein Sequence
MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVVASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFLGLFPYFYTVTSQIIVTFAL AVLVIGTVIVYGFFKHGLGFLKLFVPSGVPGIIVPLVVAIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLAALGPIGIGGAVLPLIMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Ochrobactrum anthropi and why is it relevant to study its ATP synthase components?

Ochrobactrum anthropi is an aerobic Gram-negative bacterium that has gained significant attention in the research community due to its increasing recognition as an opportunistic and nosocomial pathogen. This organism possesses robust survival abilities, enabling it to persist in challenging environments including antiseptic solutions and on invasive medical devices. O. anthropi has the ability to form biofilms, which contributes to its pathogenicity and survival in hospital settings .

The ATP synthase complex is critical to bacterial energy metabolism, and studying specific components like the atpB1 subunit provides insights into bacterial bioenergetics, potential antimicrobial targets, and comparative bacterial physiology. The interest in recombinant subunits stems from both basic research needs and potential applications in developing targeted therapeutics against this emerging pathogen .

How does ATP synthase function in O. anthropi compared to other bacterial species?

While the core mechanism remains conserved, reconstitution experiments with hybrid systems (similar to those performed with Rhodospirillum rubrum and E. coli components) suggest significant functional differences when components from different species are mixed. These differences manifest in ATP synthesis rates, hydrolysis capabilities, and sensitivity to inhibitors such as oligomycin . The ATP synthase in O. anthropi shows unique adaptations that may contribute to its survival in diverse environments, including the human host during infection.

What are the optimal expression systems for producing recombinant O. anthropi atpB1?

The expression of recombinant O. anthropi atpB1 requires careful consideration of expression systems due to the membrane-associated nature of this protein. Based on comparative studies with similar ATP synthase subunits, the following expression systems have proven effective:

For optimal expression, induction with 0.5 mM IPTG at lower temperatures (16-20°C) for extended periods (16-24 hours) often improves the yield of properly folded protein. Codon optimization for E. coli expression may be necessary given the different codon usage patterns between O. anthropi and E. coli .

What purification strategies yield the highest purity and activity for recombinant atpB1?

A multi-step purification approach is recommended to obtain high-purity active atpB1:

  • Membrane fraction isolation: Following cell lysis, differential centrifugation can separate membrane fractions containing the target protein.

  • Detergent solubilization: Careful selection of detergents is critical - mild non-ionic detergents like DDM (n-dodecyl-β-D-maltoside) at 1-2% (w/v) are effective in extracting membrane proteins while preserving structure and function.

  • Affinity chromatography: Using fusion tags (His6, GST, or Strep-tag II) facilitates selective capture. For His-tagged constructs, IMAC with Ni-NTA resin using imidazole gradients (50-300 mM) yields good results.

  • Size exclusion chromatography: As a polishing step, SEC removes aggregates and impurities.

  • Tag removal: Consider using TEV or PreScission protease cleavage sites if the tag might interfere with functional studies.

Purification buffers should contain appropriate detergent concentrations (typically 0.02-0.05% DDM), glycerol (10-20%) to stabilize the protein, and reducing agents like DTT or TCEP to prevent oxidation of cysteine residues .

How can researchers assess the structural integrity of recombinant atpB1?

Multiple complementary techniques should be employed to comprehensively evaluate the structural integrity of recombinant atpB1:

  • Circular Dichroism (CD) spectroscopy: Provides information on secondary structure elements. For membrane proteins like atpB1, special consideration for detergent background is crucial.

  • Thermal stability assays: Differential scanning fluorimetry (DSF) with appropriate membrane protein dyes can assess protein stability under various conditions.

  • Limited proteolysis: Controlled digestion with proteases like trypsin can reveal the accessibility of cleavage sites, indicating proper folding.

  • Negative stain electron microscopy: Provides low-resolution structural information and homogeneity assessment.

  • Crosslinking mass spectrometry: Reveals spatial relationships between domains and can confirm proper tertiary structure formation.

For comprehensive structural analysis, researchers should consider reconstituting the protein into nanodiscs or liposomes to better mimic its native membrane environment, which is essential for proper folding and function of this membrane-spanning component of ATP synthase .

What functional assays can verify the activity of recombinant atpB1 in reconstituted systems?

To verify functional activity of recombinant atpB1, the following assays can be employed:

  • Proton translocation assays: Using pH-sensitive fluorescent dyes (e.g., ACMA or quinacrine) to monitor proton movement across reconstituted liposomes. Active atpB1 should facilitate proton translocation when incorporated into complete ATP synthase complexes.

  • ATP synthesis/hydrolysis coupling: Measuring ATP synthesis driven by artificially imposed proton gradients can assess if atpB1 correctly couples proton flow to ATP synthesis. This can be quantified using luciferase-based ATP detection systems.

  • Inhibitor sensitivity profiles: Testing sensitivity to specific inhibitors like oligomycin or dicyclohexylcarbodiimide (DCCD) that target the Fo portion of ATP synthase can confirm proper functional assembly .

  • Hybrid reconstitution assays: Similar to studies with other bacterial systems, hybrid reconstitution with components from different species (e.g., using F1 components from E. coli with O. anthropi Fo components) can reveal specific functional properties of atpB1 .

  • Membrane potential measurements: Using potential-sensitive dyes to monitor membrane potential changes during ATP synthase activity in proteoliposomes.

The data should be interpreted with caution, as hybrid systems may exhibit partial functionality. For example, research with similar systems showed that when E. coli β-subunits were reconstituted with Rhodospirillum rubrum components, ATP synthesis was restored to only 10% while hydrolysis activity reached 200% of the homologous system .

How can recombinant atpB1 be used to study O. anthropi pathogenicity and antibiotic resistance?

Recombinant atpB1 provides valuable tools for investigating pathogenicity mechanisms and antibiotic resistance in O. anthropi:

  • Antibody development: Purified recombinant atpB1 can be used to raise specific antibodies for detection and localization studies during infection processes.

  • Drug target validation: ATP synthase can be evaluated as a potential therapeutic target through binding and inhibition studies with recombinant components.

  • Structure-based drug design: Structural information from recombinant atpB1 can guide development of specific inhibitors targeting the ATP synthase complex.

  • Biofilm formation studies: As O. anthropi is known to form biofilms contributing to its persistence in hospital environments, the relationship between ATP synthase activity and biofilm formation can be investigated using reconstituted systems with recombinant components .

  • Energy metabolism during infection: Using recombinant components to understand how energy production changes during different phases of infection can reveal adaptation mechanisms of this opportunistic pathogen.

Given O. anthropi's increasing recognition as a nosocomial pathogen with intrinsic resistance to β-lactam antibiotics, and the identification of various resistance determinants including metal-dependent hydrolases of the β-lactamase superfamily, understanding its energy metabolism machinery provides potential alternative therapeutic approaches .

What challenges arise when designing experiments with recombinant atpB1 and how can they be addressed?

Researchers face several key challenges when working with recombinant atpB1:

  • Membrane protein solubility: atpB1 is a membrane protein and tends to aggregate when expressed recombinantly. This can be addressed by:

    • Optimizing detergent type and concentration during extraction and purification

    • Using fusion partners known to enhance membrane protein solubility

    • Exploring nanodiscs or amphipols as alternative solubilization strategies

  • Maintaining native conformation: The function of atpB1 depends on correct folding and orientation. Solutions include:

    • Reconstituting the protein into liposomes with defined lipid composition

    • Performing quality control using multiple biophysical techniques

    • Including stabilizing agents like glycerol in all buffers

  • Functional reconstitution complexity: The a-subunit functions as part of the larger ATP synthase complex. To address this:

    • Co-express with other Fo components when possible

    • Develop partial complex reconstitution approaches

    • Use labeled subunits to track interaction and assembly

  • Species-specific differences: When performing comparative studies with other bacterial ATP synthases, consider:

    • The observed differences in inhibitor sensitivity between species (e.g., oligomycin sensitivity varies significantly)

    • Differences in proton translocation efficiency in hybrid systems

    • Variations in ATP synthesis vs. hydrolysis ratios in reconstituted systems

  • Data interpretation complexities: Results from hybrid systems may not directly translate to native function, as seen in studies where ATP synthesis and hydrolysis rates differed dramatically in hybrid systems compared to homologous reconstitutions .

How does O. anthropi atpB1 compare structurally and functionally to ATP synthase components in other pathogens?

Comparative analysis reveals both conserved features and unique characteristics of O. anthropi atpB1:

FeatureO. anthropi atpB1E. coli subunit aMycobacterial homologsClinical Relevance
Sequence identityReference40-45%30-35%Impacts cross-reactivity of targeted therapeutics
Inhibitor sensitivityModerate oligomycin sensitivityLow oligomycin sensitivityHigh sensitivity to bedaquilineDetermines effectiveness of specific ATP synthase inhibitors
Proton channel residuesConserved key residuesWell-characterizedContains unique substitutionsCritical for energy conversion efficiency
Membrane topologyPredicted 5 transmembrane helices5 transmembrane helices5 transmembrane helicesAffects protein stability and assembly

Proteomic studies have shown that ATP synthase components in O. anthropi demonstrate unique expression patterns during different growth phases, suggesting specific regulatory mechanisms that may be adapted to its lifestyle as an opportunistic pathogen .

What insights have proteomic studies provided about ATP synthase expression in O. anthropi under different conditions?

Proteomic analyses have revealed dynamic expression patterns of ATP synthase components including atpB1 in O. anthropi:

Key findings regarding ATP synthase expression include:

These proteomic insights suggest that ATP synthase expression and assembly in O. anthropi is precisely regulated in response to environmental conditions, which may have implications for its pathogenicity and resistance to stress conditions encountered during infection .

What role might atpB1 play in O. anthropi's adaptation to diverse environments and antibiotic resistance?

The atpB1 subunit and ATP synthase function may contribute significantly to O. anthropi's environmental adaptability and antibiotic resistance through several mechanisms:

  • Energy modulation during stress: The ability to regulate ATP production under various stress conditions likely contributes to O. anthropi's robust survival capabilities in hospital environments, including antiseptic solutions and medical devices .

  • Membrane potential maintenance: ATP synthase activity affects bacterial membrane potential, which in turn influences susceptibility to certain antimicrobials. Changes in atpB1 function could modulate this susceptibility.

  • Metabolic flexibility: Proteomic studies have demonstrated that O. anthropi modulates its central metabolic pathways (including energy production) during different growth phases, suggesting adaptive capabilities that may contribute to its persistence .

  • Oxidative stress response integration: The coordination between ATP synthase expression and oxyR regulon proteins indicates that energy metabolism modulation is integrated with oxidative stress responses, which are critical for bacterial survival during host immune responses .

  • Biofilm formation support: ATP synthase activity provides energy for biofilm production and maintenance, contributing to O. anthropi's ability to form biofilms on medical devices, thus enhancing its virulence potential and resistance to antimicrobials .

Research on carbapenem-resistant O. anthropi has identified various resistance determinants, including β-lactamases and metal-dependent hydrolases. The maintenance of these resistance mechanisms requires energy, suggesting an indirect role for ATP synthase in supporting antibiotic resistance .

How might structural information about atpB1 inform development of targeted therapeutics against O. anthropi?

Detailed structural characterization of atpB1 could significantly advance therapeutic development through several approaches:

  • Structure-based inhibitor design: Identifying unique structural features or binding pockets in O. anthropi atpB1 could enable the design of selective inhibitors that target this pathogen's energy production system without affecting human ATP synthase or commensal bacteria.

  • Disruption of protein-protein interactions: Understanding the interaction interfaces between atpB1 and other ATP synthase components could lead to the development of peptides or small molecules that specifically disrupt complex assembly.

  • Functional coupling targets: The mechanism of proton translocation coupling to ATP synthesis involves critical residues in the a-subunit. Structural information could reveal O. anthropi-specific aspects of this coupling that could be targeted.

  • Regulatory site identification: Structural studies might reveal unique regulatory sites that respond to environmental conditions, providing opportunities for targeting O. anthropi's adaptive capabilities.

  • Cross-species comparability assessment: Structural comparison with ATP synthase components from other pathogens could identify conserved features that might allow development of broad-spectrum inhibitors, or unique features enabling selective targeting.

The emergence of carbapenem-resistant O. anthropi strains highlights the urgent need for alternative therapeutic strategies. The essential nature of ATP synthase for bacterial survival makes it an attractive target, particularly if structural differences between bacterial and human homologs can be exploited .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.